BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0255.Seq (505 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0746 - 31636024-31641396 30 1.2 03_01_0312 + 2469096-2470862 29 2.1 05_07_0022 - 27103367-27103533,27103783-27103852,27104074-271042... 28 3.7 10_08_0299 - 16607152-16607322,16607465-16607785,16607870-166081... 28 4.9 >01_06_0746 - 31636024-31641396 Length = 1790 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +3 Query: 297 LAQIP-VVWRPPMLRSPCLTLSQSVSIALSLSFSLHFD 407 L ++P VVWR ++R PCL L + +ALS + L D Sbjct: 682 LLELPAVVWRIRVVRWPCLLLKNELLLALSQAAELVAD 719 >03_01_0312 + 2469096-2470862 Length = 588 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +3 Query: 282 WHRSSLAQIPVVWRPPMLRSPCLTLSQSVSIALSLSFSLHFDTS 413 W+ ++ + V++R M + CLT S++ A+ + F FD + Sbjct: 184 WYATNQFMVDVIFRNRMKQYECLTKDSSIAAAVFVPFYAGFDVA 227 >05_07_0022 - 27103367-27103533,27103783-27103852,27104074-27104215, 27104372-27104552,27104654-27104756 Length = 220 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 165 TLHSRLVHFSRI*FTESCARILR 233 TLHS++ HFS + + SC + LR Sbjct: 116 TLHSKVAHFSAVLYDISCGKELR 138 >10_08_0299 - 16607152-16607322,16607465-16607785,16607870-16608121, 16608298-16608435,16608544-16608651,16608814-16609014, 16609109-16609233,16609252-16609321,16609919-16610455 Length = 640 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 3/53 (5%) Frame = +1 Query: 85 STKLESFSSLELYKP*---SLSRSATCGVVLCTRGSFTFLVFDSQNLALAFYV 234 ++KL+SF LE ++ SLS S T LC GS ++D L L ++ Sbjct: 205 NSKLQSFRQLEPFEGHQVRSLSWSPTSDRFLCVTGSAQAKIYDRDGLTLGEFI 257 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,397,119 Number of Sequences: 37544 Number of extensions: 197312 Number of successful extensions: 517 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1071221400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -