BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0245.Seq (906 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0755 - 6343084-6345172,6345526-6346367 31 1.3 03_03_0237 + 15706391-15706699 29 5.1 >11_01_0755 - 6343084-6345172,6345526-6346367 Length = 976 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 6/54 (11%) Frame = +1 Query: 118 RTNCKHYKIT*SILFKADKKM------QSMSPRFTTATILGYIDEISLDYVKCE 261 R+ C+H +T S+ M + PR + TI G E +LDY KCE Sbjct: 524 RSKCRHLFLTQSLTSGNQSYMDCGTNPKGKQPRARSLTIFGNAGEFALDYAKCE 577 >03_03_0237 + 15706391-15706699 Length = 102 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +2 Query: 815 GPLRGTIXPXQG--FLGAXGALKPXNPGAPKG 904 G + GTI P +G F GA ++P NPG G Sbjct: 50 GVMEGTITPTEGEGFAGANDDVRPTNPGHSPG 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,432,790 Number of Sequences: 37544 Number of extensions: 346455 Number of successful extensions: 645 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2565528060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -