BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0241.Seq (534 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0627 + 4685077-4685155,4685978-4686336,4686761-4686862,468... 32 0.25 04_01_0508 + 6647812-6647820,6647864-6648226,6649351-6650673,665... 29 1.8 10_02_0086 - 5112095-5112185,5112487-5112599,5113325-5113431,511... 27 7.2 08_01_0675 - 5840867-5841253,5842699-5842997,5844022-5844202 27 9.5 04_04_0945 - 29561874-29562057,29563244-29563512 27 9.5 01_06_0894 - 32781957-32782287,32783019-32783284,32783771-327840... 27 9.5 >07_01_0627 + 4685077-4685155,4685978-4686336,4686761-4686862, 4687528-4687598,4687871-4687989,4688327-4688422, 4688527-4688636,4688734-4688814,4689124-4689224, 4689663-4689771,4689971-4690076,4690140-4690225, 4690324-4690449,4690816-4690902 Length = 543 Score = 32.3 bits (70), Expect = 0.25 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Frame = -2 Query: 209 DKYHXPLNKIICEETIRLGGSMVHHHGIG---KHRVXWSKLEHGSAWALLEGLKKQFDPN 39 DK + + E T + GS+ HG+G ++ +SK A L+ +KK DPN Sbjct: 472 DKMLAQIEPFVYEWTSKQRGSISAEHGLGLMKAEKIHYSK--SSEAVQLMASIKKLLDPN 529 Query: 38 GIMN 27 I+N Sbjct: 530 SILN 533 >04_01_0508 + 6647812-6647820,6647864-6648226,6649351-6650673, 6653569-6653766,6654485-6654568,6655175-6655920, 6656480-6657341 Length = 1194 Score = 29.5 bits (63), Expect = 1.8 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -2 Query: 443 TCADHQNRQHGLYHRSIRLLELHPRNLRKR 354 TC++H+N QH ++ R +L+ P+ + R Sbjct: 642 TCSNHENLQHAIFLRKAGMLDNRPQEEKDR 671 >10_02_0086 - 5112095-5112185,5112487-5112599,5113325-5113431, 5113782-5113860,5114000-5114089,5114628-5114882, 5117025-5117174,5117634-5117933 Length = 394 Score = 27.5 bits (58), Expect = 7.2 Identities = 17/41 (41%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -2 Query: 470 WGPDXSGCXTCADHQNRQHGLYHRSIRLLELH---PRNLRK 357 W PD D R HGL HR I+ L L P NLR+ Sbjct: 29 WYPDSFIRIIGTDSLIRTHGLLHRHIKNLALRLFGPENLRR 69 >08_01_0675 - 5840867-5841253,5842699-5842997,5844022-5844202 Length = 288 Score = 27.1 bits (57), Expect = 9.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 128 YRGGAPSNRRGEWFLH 175 YRG AP R+ EW +H Sbjct: 133 YRGRAPKGRKTEWVMH 148 >04_04_0945 - 29561874-29562057,29563244-29563512 Length = 150 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 86 CRVPVCSSXRDVYRYRGGAP 145 CR P+ S+ RD+Y YRG P Sbjct: 76 CRKPLASN-RDIYMYRGDIP 94 >01_06_0894 - 32781957-32782287,32783019-32783284,32783771-32784040, 32785007-32785134,32785284-32785893 Length = 534 Score = 27.1 bits (57), Expect = 9.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 89 GSAWALLEGLKKQFDPNGIMNTG 21 G+ WA LK +FDP ++ TG Sbjct: 499 GARWARFARLKAEFDPRAMLATG 521 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,438,934 Number of Sequences: 37544 Number of extensions: 258359 Number of successful extensions: 630 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1190246000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -