BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0240.Seq (910 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0328 - 23170019-23170168,23170865-23170903,23171043-231711... 31 1.7 01_01_0282 - 2349336-2349583,2349719-2349786,2349880-2349950,235... 30 2.2 04_04_0330 + 24456200-24456261,24456385-24456520,24457100-244571... 29 5.1 01_01_1214 - 9793854-9794003,9795418-9795456,9795604-9795702,979... 29 6.7 11_06_0157 - 20754134-20755085,20755311-20755642 28 8.9 03_02_0067 + 5364713-5364936,5365513-5367016,5367207-5368250,536... 28 8.9 >03_05_0328 - 23170019-23170168,23170865-23170903,23171043-23171141, 23171214-23171342,23171915-23172061,23172959-23173089, 23173938-23174157,23174294-23174387,23174469-23174581, 23174727-23174861,23175231-23175335,23175440-23175544, 23176240-23176327,23176415-23176536,23176611-23176670, 23177434-23177529,23177620-23177772,23177865-23177951, 23179179-23179246,23179603-23179726,23180235-23180330, 23180430-23180539,23180647-23180761,23181622-23181699, 23181843-23181908,23182203-23182363,23182781-23183099 Length = 1069 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 221 LKILSFFRREPRIRSSILMFTCRDSISKASK*TRPSKSSN 340 LK +S + EP + + +L F C ++KA + T S S N Sbjct: 754 LKAISLYADEPEVTTPLLKFMCEFVLNKAQRLTFDSSSPN 793 >01_01_0282 - 2349336-2349583,2349719-2349786,2349880-2349950, 2350022-2350123,2350309-2350449,2350540-2350716, 2352228-2352338 Length = 305 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 246 ESPASVLLFSCSLAGIASLRLPSELDLQNRQ 338 +SPA V LFS SL+GIAS LDL R+ Sbjct: 204 DSPAVVSLFSGSLSGIASSTATFPLDLVKRR 234 >04_04_0330 + 24456200-24456261,24456385-24456520,24457100-24457165, 24457260-24457310,24457399-24457455,24457742-24457827, 24458207-24458216,24458385-24458450,24458744-24458784, 24460050-24460182,24460857-24461045,24461145-24461219, 24462228-24462358,24463155-24463229,24463385-24463562 Length = 451 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 793 NFQTRGGELSLMDTVRNAVGSGNDNAGXE 879 +F GG SL+D + N VG GN G E Sbjct: 228 SFSFHGGMQSLIDALHNEVGDGNVKLGTE 256 >01_01_1214 - 9793854-9794003,9795418-9795456,9795604-9795702, 9795779-9795907,9796473-9796619,9797513-9797643, 9798497-9798716,9798858-9798951,9799021-9799133, 9799799-9799903,9800008-9800112,9800762-9800849, 9800933-9801054,9801130-9801189,9802313-9802408, 9802506-9802658,9802752-9802838,9803995-9804062, 9804429-9804552,9805057-9805152,9805250-9805359, 9805459-9805573,9806877-9806942,9807260-9807420, 9807927-9808167 Length = 972 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 221 LKILSFFRREPRIRSSILMFTCRDSISKASK*TRPSKSSN 340 LK +S EP + + +L F C ++KA + T S S N Sbjct: 657 LKAISLCADEPEVTTPLLKFMCEFVLNKAQRLTFDSSSPN 696 >11_06_0157 - 20754134-20755085,20755311-20755642 Length = 427 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -1 Query: 286 ASEHENRRTDAGLSPEKRQDLKE 218 ASEHEN R GL PE +D E Sbjct: 279 ASEHENWRAGDGLKPESDEDEDE 301 >03_02_0067 + 5364713-5364936,5365513-5367016,5367207-5368250, 5368467-5368577,5368997-5369068,5369719-5369737, 5369838-5371142,5371317-5371397,5372441-5372604, 5373363-5373466,5373537-5373628,5374079-5374216, 5374370-5374426,5374820-5375046 Length = 1713 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 276 CSLAGIASLRLPSELDLQNRQTN 344 C LA + S+ LP ELD +N N Sbjct: 1204 CELADLISVHLPQELDCENNSLN 1226 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,427,898 Number of Sequences: 37544 Number of extensions: 324870 Number of successful extensions: 958 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2577242800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -