BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0238.Seq (519 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0213 + 26815889-26816475,26817718-26817788,26817985-268180... 31 0.42 06_03_0872 - 25575201-25575312,25576027-25576133,25577096-255771... 28 5.2 10_08_0663 - 19666476-19667017,19667664-19667755,19668039-196680... 27 9.0 >02_05_0213 + 26815889-26816475,26817718-26817788,26817985-26818073, 26818910-26818991,26819089-26819204,26819290-26819451, 26819531-26819680,26819969-26820037,26820375-26820491 Length = 480 Score = 31.5 bits (68), Expect = 0.42 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +1 Query: 61 LMAWVVSVSISRVLAERHYLLDSXXXXXXXXLEGLFMSLI 180 L W S S SRVL RHY+LD E SL+ Sbjct: 153 LFLWAASTSASRVLLGRHYVLDVVAGACLGVFEAWLSSLL 192 >06_03_0872 - 25575201-25575312,25576027-25576133,25577096-25577166, 25577294-25577391,25577490-25577586,25577834-25577878, 25578269-25578413 Length = 224 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/51 (23%), Positives = 33/51 (64%), Gaps = 2/51 (3%) Frame = -1 Query: 405 FMTQLHVCNGPSLLIFIKQY--LTILK*Y*FILSILESFRLSKCLIKKIMF 259 F+ L +C+GP+LL+ + ++ +T+L+ + ++ES + + +++++F Sbjct: 40 FLFLLGLCHGPALLVDVPRHSNVTVLRKLRYAAEVMESLNIPRG-VRRVLF 89 >10_08_0663 - 19666476-19667017,19667664-19667755,19668039-19668095, 19668304-19668447,19668567-19668613,19668733-19668791, 19668975-19669045,19669274-19669341,19669431-19669598, 19669885-19669944,19670075-19670251 Length = 494 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +2 Query: 143 VLEFLKVSSCPSYGCPKVHLLVFCHHCLMKN*MVEN 250 ++ F K+ S P+ G L FC+ C++ V++ Sbjct: 354 IMSFTKLPSTPTEGLKSSSALTFCNPCMLNTRSVDS 389 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,156,425 Number of Sequences: 37544 Number of extensions: 214443 Number of successful extensions: 389 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 389 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -