BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0229.Seq (901 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0036 + 3217163-3217584,3217752-3218322 34 0.18 04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902,420... 31 1.2 11_04_0045 + 12731603-12732487,12732572-12732647,12744290-12745371 30 2.2 05_03_0258 - 11153709-11156090 30 2.9 10_01_0340 - 3734116-3734178,3734212-3734300,3734785-3734844,373... 29 5.0 12_01_0943 - 9324181-9325095,9326671-9326853 29 6.7 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +2 Query: 503 ESITIHWPSFYNVV-TGKTLALPNLIALQH 589 ESI+ W F N+V +G TL++PN + LQH Sbjct: 67 ESISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902, 4208006-4208297,4209278-4209569,4210013-4210465 Length = 783 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +2 Query: 500 SESITIHWPSFYNVV-TGKTLALPNLIALQH 589 +ESI W F N+V +G TL+LP + LQH Sbjct: 126 NESIGAAWSRFTNLVQSGPTLSLPEYVLLQH 156 >11_04_0045 + 12731603-12732487,12732572-12732647,12744290-12745371 Length = 680 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 503 ESITIHWPSFYNVV-TGKTLALPNLIALQH 589 ESI W F N+V +G TL+LP + LQH Sbjct: 408 ESIGAAWSRFTNLVQSGLTLSLPEYVLLQH 437 >05_03_0258 - 11153709-11156090 Length = 793 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -3 Query: 698 NINAYNLPFAHFXCATVGKGRSVRASSLLRQLAKGGCAARRLSWVT 561 N+N YNL F K R +L ++++ GC R++W T Sbjct: 390 NVNTYNLIFGMLG----KKSRFTAMLEMLEEMSRSGCTPNRVTWNT 431 >10_01_0340 - 3734116-3734178,3734212-3734300,3734785-3734844, 3736188-3736245,3736507-3736893,3736942-3737615, 3739154-3739203,3739903-3739943,3740721-3740860, 3740903-3741183,3741405-3741613 Length = 683 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +2 Query: 500 SESITIHWPSFYNVV-TGKTLALPNLIALQH 589 +ESI W F N++ +G TL+LP + LQH Sbjct: 274 NESIGAAWSRFTNLLQSGPTLSLPEYMLLQH 304 >12_01_0943 - 9324181-9325095,9326671-9326853 Length = 365 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 500 SESITIHWPSFYNVV-TGKTLALPNLIALQHIPLS 601 +ESI W F N+V +G L+LP + LQH S Sbjct: 191 NESIGAAWSRFTNLVQSGPILSLPEYVFLQHFHTS 225 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,390,261 Number of Sequences: 37544 Number of extensions: 498798 Number of successful extensions: 1282 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1281 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2542098580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -