BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0227.Seq (928 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0161 + 1307206-1307769,1307979-1308101,1308182-1308286,130... 31 1.3 10_08_1048 - 22553676-22554866 30 2.3 09_01_0019 + 403078-404211 28 9.2 01_05_0511 - 22831889-22832523,22833743-22833835,22834018-228342... 28 9.2 >03_01_0161 + 1307206-1307769,1307979-1308101,1308182-1308286, 1308688-1308867,1308988-1309050,1309151-1309345, 1309704-1309805,1309885-1309947,1310045-1310113, 1310215-1310270,1310587-1310755 Length = 562 Score = 31.1 bits (67), Expect = 1.3 Identities = 25/89 (28%), Positives = 37/89 (41%) Frame = +3 Query: 3 SLPPRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES**GRHLKDA 182 S PP S +RL + S AP P + +P P + V ++ I S G +L Sbjct: 7 SKPPTPASTPSSRLAAAPSSRVSSAAPHPSPSSSAPTPASRTVYSDRFIPSRAGSNL--- 63 Query: 183 SPVLDHAICKSYPDSSKLTTSDARPPSIG 269 + D A S+ D++ S PP G Sbjct: 64 -ALFDLAPSPSHHDAAAAAASPGAPPPSG 91 >10_08_1048 - 22553676-22554866 Length = 396 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 183 SPVLDHAICKSYPDSSKLTTSDARPPSIGFDLIK 284 SP+ D A+ +P +K T+ PPS+GFDL + Sbjct: 175 SPLPDSAV--RWPPGAKCTSFSCLPPSLGFDLAR 206 >09_01_0019 + 403078-404211 Length = 377 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 109 GESGFDSGEGA*ETATTSKEGSRRANYPLPARGGSD 2 G S DSG GA ++A K SRR + GSD Sbjct: 321 GASDGDSGSGASDSADDRKRSSRRRRHRKSESSGSD 356 >01_05_0511 - 22831889-22832523,22833743-22833835,22834018-22834215, 22834365-22834494,22834596-22834714,22835244-22835487, 22835607-22835807 Length = 539 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 203 DLQKLSRFIKINDFGREASVDWF*SNKSTHP 295 +L KL +K+ DFG +AS+ +F ++ HP Sbjct: 143 NLTKLLDTLKLEDFGLDASMPYFRADPQGHP 173 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,355,840 Number of Sequences: 37544 Number of extensions: 472951 Number of successful extensions: 1012 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 989 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1012 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2647531240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -