BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0222.Seq (357 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1018 - 8046819-8046876,8046995-8047212,8048099-8048177,804... 27 5.7 11_06_0259 - 21757190-21758467 26 7.6 >01_01_1018 - 8046819-8046876,8046995-8047212,8048099-8048177, 8048455-8048540,8048698-8048983,8049063-8049205, 8049308-8049508,8049626-8049754,8050463-8050738, 8050823-8051098,8051364-8052364,8052452-8052634, 8052865-8052937,8053205-8053313,8053622-8053785 Length = 1093 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 167 FLDRRKTNXSESICQRCFHQSRTKXRGSKAIRY 69 +++ N SIC RC H S K + K Y Sbjct: 561 YVEVENGNDKSSICGRCHHLSSAKAKYQKRFSY 593 >11_06_0259 - 21757190-21758467 Length = 425 Score = 26.2 bits (55), Expect = 7.6 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 192 SYCDVRGEILGSSQDEXQRKHLPK 121 S+ D RG ++ S+QD R+H P+ Sbjct: 136 SFTDDRGRLMYSNQDNWMRRHDPQ 159 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,159,029 Number of Sequences: 37544 Number of extensions: 122549 Number of successful extensions: 214 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 214 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 542368620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -