BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0221.Seq (907 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0036 + 3217163-3217584,3217752-3218322 30 2.2 03_05_0941 + 29008322-29009686,29009929-29010012,29010889-290110... 28 8.9 01_07_0351 + 42952504-42952692,42952824-42952910,42953039-429532... 28 8.9 >09_02_0036 + 3217163-3217584,3217752-3218322 Length = 330 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 655 ITIHWPSFYNVV-TGKTLALPNLIALQH 735 I+ W F N+V +G TL++PN + LQH Sbjct: 69 ISAGWSRFINLVQSGPTLSIPNYVLLQH 96 >03_05_0941 + 29008322-29009686,29009929-29010012,29010889-29011052, 29011208-29011233,29011494-29011583,29012135-29012229, 29012328-29012495 Length = 663 Score = 28.3 bits (60), Expect = 8.9 Identities = 10/23 (43%), Positives = 19/23 (82%), Gaps = 1/23 (4%) Frame = +1 Query: 682 NVVTGKTLALPNLIALQHI-PLF 747 N +TG+ +ALP++I ++H+ P+F Sbjct: 171 NPITGEQIALPSVITIEHVNPIF 193 >01_07_0351 + 42952504-42952692,42952824-42952910,42953039-42953257, 42953329-42953502,42954799-42954852,42954983-42955123, 42955599-42955637,42956689-42957045 Length = 419 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +1 Query: 127 PQYSYGYDVQDTLTGDFKGHQENRNGDLVTGSY 225 PQY Y Y V L GD + HQ R DL G++ Sbjct: 278 PQYEYDYLVWKVLAGDRRHHQ--RPKDLAGGNW 308 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,179,914 Number of Sequences: 37544 Number of extensions: 327177 Number of successful extensions: 731 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 719 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 731 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2565528060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -