BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0208.Seq (887 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0137 - 1082786-1082846,1083850-1084142,1084250-1084550,108... 28 8.6 >03_01_0137 - 1082786-1082846,1083850-1084142,1084250-1084550, 1084792-1084862,1085008-1085115,1085205-1085279, 1085298-1085440,1087848-1088097 Length = 433 Score = 28.3 bits (60), Expect = 8.6 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 2/97 (2%) Frame = +1 Query: 268 PLSPAGVIAKRPAPIALPNSCAXEWRMANCKR*YFVKIRVKFLLNQLIF*PIGRNRQNPL 447 PL G++ P+PI L ++ + Y + + FLL +IF PIG + Sbjct: 97 PLLTPGIVTC-PSPILLSSNMHIILPIRFMSSFYAIVVAT-FLLIGIIFVPIGLASLSAS 154 Query: 448 *--IKRIDRDRVECCSSLEQESILKNVDSNVKGRKTV 552 ++ +DR C S+L++ ++N D++ +T+ Sbjct: 155 QEIVELVDRYDTNCVSTLDKVGFIQNTDTDKTCTRTL 191 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,975,287 Number of Sequences: 37544 Number of extensions: 438169 Number of successful extensions: 930 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2495239620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -