BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0207.Seq (668 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0861 + 8153108-8153266,8154633-8155136 30 1.5 09_01_0019 + 403078-404211 30 1.5 03_05_1065 + 30061588-30061883,30061995-30062056,30062196-300622... 28 7.7 >12_01_0861 + 8153108-8153266,8154633-8155136 Length = 220 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = +1 Query: 349 PYRYFSSLPPRAGSG*XARLLPSLDVVAVSQAPSPESNP--DSPLPVTTMVVAE 504 P SS P G RL S +VA+ + P P S+P D P TT+ + E Sbjct: 94 PRSLLSSPSPHCQEGHDPRLCVSAGLVAIPRCPPPTSSPSLDPPESSTTVALIE 147 >09_01_0019 + 403078-404211 Length = 377 Score = 30.3 bits (65), Expect = 1.5 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -1 Query: 473 GESGFDSGEGA*ETATTSKEGSRRAXYPLPARGGSDEK*RYG 348 G S DSG GA ++A K SRR + GSD R+G Sbjct: 321 GASDGDSGSGASDSADDRKRSSRRRRHRKSESSGSDGDERHG 362 >03_05_1065 + 30061588-30061883,30061995-30062056,30062196-30062276, 30062391-30062464,30062547-30062629,30063044-30063147, 30063526-30063665,30063736-30063783,30063939-30063991, 30064178-30064262,30064346-30064412,30064496-30064606, 30065262-30065283,30066244-30071110,30071186-30071374, 30071463-30071577,30072329-30073388,30074247-30074694, 30074966-30075019,30075105-30076898,30076989-30077949, 30078271-30078384,30078459-30078613,30078934-30079026, 30079341-30079613,30093423-30093975,30094465-30094540, 30094619-30094718 Length = 4025 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 558 DHAICKSYPDSSKLTTSDARPFRRLVLI**KHSSHHW 668 D++ KSYPDS T PF +L +H H W Sbjct: 3951 DNSDPKSYPDSVTRLTRGKNPFALSILKQVEHKLHGW 3987 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,707,342 Number of Sequences: 37544 Number of extensions: 415220 Number of successful extensions: 1205 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1205 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1691314196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -