BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ps4M0206.Seq (840 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1612 + 34773218-34773414,34773655-34773738,34773871-347739... 38 0.010 01_07_0201 + 41956938-41957022,41957123-41957214,41957460-419575... 29 4.6 03_01_0325 + 2529875-2529922,2530181-2530279,2530958-2531055,253... 29 6.1 04_04_0028 - 22243272-22243577,22244564-22244713,22244919-222456... 28 8.1 >04_04_1612 + 34773218-34773414,34773655-34773738,34773871-34773944, 34774312-34774388,34774491-34774527,34774691-34774776, 34775048-34775107,34775216-34775361,34775780-34775906, 34776164-34776319,34776409-34776519,34776725-34776835, 34777040-34777138,34777316-34777444 Length = 497 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/42 (33%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -2 Query: 377 VHICHVA-RKEEILIIKAAKERGVKVTCEVCPHHLFLNSNDI 255 +HI H++ K + ++K AK+ G +V+ E CPH+L ++ ++ Sbjct: 280 IHIVHLSDAKTSLGLLKDAKQNGARVSVETCPHYLAFSAEEV 321 >01_07_0201 + 41956938-41957022,41957123-41957214,41957460-41957561, 41957691-41957763,41958297-41958403,41958476-41958599, 41959004-41959198,41959515-41959600,41959695-41959802, 41960171-41960266,41960347-41960445,41960562-41960636, 41961040-41961171,41961252-41961367,41961935-41962109 Length = 554 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 Query: 832 GNIVKLPGFIDVHVHVREPGANI 764 GN+V LPGFID HVH + G + Sbjct: 73 GNVV-LPGFIDSHVHFIDGGLQL 94 >03_01_0325 + 2529875-2529922,2530181-2530279,2530958-2531055, 2531945-2532031,2532652-2532684,2532813-2532890, 2533059-2533183,2533267-2533349,2533436-2533527, 2533611-2533680,2533760-2533829,2533919-2534073 Length = 345 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -2 Query: 320 ERGVKVTCEVCPHHLFLNSNDITKLEKGEQKYVQYYVVLKTKQNF 186 ER + C VC +LF ++ DI+ L G +++ +++ Q F Sbjct: 205 ERAMHHNCPVCFEYLFDSTKDISALHCGHTIHLECLYEMRSHQQF 249 >04_04_0028 - 22243272-22243577,22244564-22244713,22244919-22245656, 22247233-22247331,22247541-22247933,22248806-22248961 Length = 613 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -1 Query: 117 SENPPPGYPGLETILPLLLNAVHQGRLTIEDLLC 16 S PP + G + L LN VH R +E++LC Sbjct: 361 SLQPPSWFGGFPNLRKLELNLVHVTRKELENMLC 394 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,957,767 Number of Sequences: 37544 Number of extensions: 440609 Number of successful extensions: 983 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 955 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2326952232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -