SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0113
         (659 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_02_0054 - 6398829-6399047,6399470-6399676,6399858-6400557,640...    34   0.12 
08_02_0020 + 11303438-11304213,11304321-11304699                       28   5.7  
03_01_0607 + 4464669-4465367,4466212-4467369,4468005-4469114,446...    28   7.6  
01_05_0005 - 16886553-16886946,16887079-16887404                       28   7.6  

>02_02_0054 -
           6398829-6399047,6399470-6399676,6399858-6400557,
           6400927-6401120
          Length = 439

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +3

Query: 255 IWITFADRMVKYRRRIFQMSALSTFDGSFCDYHGCHG*RGIKVRFRRGSLRNGYHI 422
           +WITFA  MV    +   +++  T DG     H   G  GI V+F R  +    H+
Sbjct: 158 LWITFAKSMVIRLTQELLVASDKTIDGRGAQVHIARGGAGITVQFARNVIITSLHV 213


>08_02_0020 + 11303438-11304213,11304321-11304699
          Length = 384

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
 Frame = +3

Query: 255 IWITFA-DRMVKYRRRIFQMSALSTFDGSFCDYHGCHG*RGIKVRFRRGSLRNGYHI 422
           +WITFA D  ++  + ++ +   +T DG   D H   G  GI +   R  + +G H+
Sbjct: 97  VWITFARDMRIRLAQPLY-VKNFTTIDGRGADVHVAGG-AGIVLYHARDVIVHGLHV 151


>03_01_0607 +
           4464669-4465367,4466212-4467369,4468005-4469114,
           4469273-4469314,4469496-4469572,4469671-4469755,
           4469818-4469901,4469988-4470089,4470181-4470279,
           4470794-4470919
          Length = 1193

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = -1

Query: 557 SNCASLKYLKCTHSDYGPRKSPVS 486
           +N  ++K L C   DYGP   P+S
Sbjct: 564 TNLTAIKILSCILEDYGPASVPIS 587


>01_05_0005 - 16886553-16886946,16887079-16887404
          Length = 239

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -2

Query: 622 RNNFSIRYWSWNYRGC 575
           R+N S RYW W   GC
Sbjct: 90  RSNSSFRYWRWQPHGC 105


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,824,068
Number of Sequences: 37544
Number of extensions: 390828
Number of successful extensions: 909
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 887
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 909
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1655832080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).