SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0112
         (679 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1055 - 27234824-27234838,27236087-27236125,27236322-272373...    29   3.4  
03_05_0823 - 27970038-27970258,27970279-27970544,27970608-279706...    29   3.4  
02_01_0486 - 3495792-3496034,3496862-3496934,3497128-3497422,349...    29   3.4  
03_05_1088 + 30301654-30303480                                         28   6.0  
07_03_0846 - 21983581-21986055                                         28   7.9  
02_02_0156 - 7277793-7277875,7278535-7278638,7278808-7279211,727...    28   7.9  

>06_03_1055 -
           27234824-27234838,27236087-27236125,27236322-27237388,
           27237422-27237630,27237650-27238053
          Length = 577

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 15/42 (35%), Positives = 25/42 (59%)
 Frame = -1

Query: 223 AESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGS 98
           A +GK +   E  E   S+QCD T  + +S RE ++R+P+ +
Sbjct: 433 AAAGKPISEHEAIEHLWSRQCDLTEILQNSSRE-KKRNPYAA 473


>03_05_0823 -
           27970038-27970258,27970279-27970544,27970608-27970657,
           27971272-27971538,27971633-27972001,27972373-27973278
          Length = 692

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 33/104 (31%), Positives = 44/104 (42%), Gaps = 4/104 (3%)
 Frame = +3

Query: 18  RHRTELYSDLRSR-DARVKKKTDSIDLRDPNGLRRRVSRFECET--RLVKSHCLEPPDSR 188
           RH   L  ++RS  D     KT  ++L    GL          +   L  SH L    + 
Sbjct: 144 RHVRMLTHEIRSTLDRHTILKTTLVELGGTLGLEECALWMPSRSGSSLQLSHTLRHQITV 203

Query: 189 GSTVSISLPDSARLVSALEAFRIIPRMVASHHRPL-GRVHEPNV 317
           GSTVSI+LP   ++ S+  A  I      +  RPL GR   P V
Sbjct: 204 GSTVSINLPVVNQVFSSNRAIIIPHTSPLARIRPLAGRYVPPEV 247


>02_01_0486 -
           3495792-3496034,3496862-3496934,3497128-3497422,
           3497585-3497759,3498349-3498795,3499994-3500053
          Length = 430

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
 Frame = -1

Query: 340 VREEPQFRTFGSCTRPSGRWCEATIRGIILNAS-KAETSLAESGKDMLTVEPRESGGSKQ 164
           +   P     G   RP+    +++IRGII   S KA++SL +  + +L +    S   +Q
Sbjct: 60  ISPSPNSARSGLPPRPNSTRTKSSIRGIIPQRSFKAKSSLQDGDQTILLIPDTPSSSGQQ 119

Query: 163 CDFTSRVSHS 134
              T+  S S
Sbjct: 120 VKATTSRSFS 129


>03_05_1088 + 30301654-30303480
          Length = 608

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 3/36 (8%)
 Frame = -1

Query: 271 TIRGIILNASKA--ETSLAE-SGKDMLTVEPRESGG 173
           +I G IL+AS A   T +AE + K++L +EP E GG
Sbjct: 533 SIWGSILSASSACQNTEVAEIASKELLCLEPAEEGG 568


>07_03_0846 - 21983581-21986055
          Length = 824

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +3

Query: 90  DLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSAR 227
           DL+D  G  +R    +C+T    S     PD   S VS+ LPD+A+
Sbjct: 326 DLQDFTGGCKRNVPLQCQTN--SSSAQTQPDKFYSMVSVRLPDNAQ 369


>02_02_0156 -
           7277793-7277875,7278535-7278638,7278808-7279211,
           7279403-7279543,7279700-7279904,7279984-7280093
          Length = 348

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 23/49 (46%), Positives = 25/49 (51%)
 Frame = -2

Query: 354 SNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLS*TPLRPKPA*PNPAR 208
           SNTA  ER      L  A+ R      LP AG S + LRPKP  P PAR
Sbjct: 279 SNTAAKER------LTRAVNRVQK-LTLPKAGQS-SSLRPKPRDPAPAR 319


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,842,992
Number of Sequences: 37544
Number of extensions: 390178
Number of successful extensions: 942
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 925
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 942
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1726796312
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).