SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0110
         (490 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_05_0136 - 22631260-22631325,22631735-22631821,22631898-226320...    28   4.6  
11_06_0661 - 26009838-26010950,26011302-26011802                       27   8.1  

>05_05_0136 - 22631260-22631325,22631735-22631821,22631898-22632026,
            22632122-22632190,22632271-22632351,22632598-22632702,
            22632786-22633016,22633098-22634272,22634391-22634457,
            22636705-22637778,22638119-22638274,22638827-22638985,
            22639062-22639220,22639306-22639422,22639502-22639612,
            22639690-22640358
          Length = 1484

 Score = 27.9 bits (59), Expect = 4.6
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +3

Query: 231  MEDRSDSDCKSIVGTGYRGERLIEPSSSWVRPKFP 335
            +E  S  DCKS     YRG R+ + +  +  P +P
Sbjct: 1260 LESSSSGDCKSTSDLSYRGCRIEDLAIEFALPGYP 1294


>11_06_0661 - 26009838-26010950,26011302-26011802
          Length = 537

 Score = 27.1 bits (57), Expect = 8.1
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -2

Query: 192 HHLSGPSICAQSAPSFTDWK 133
           HHL GP+  + S+P    WK
Sbjct: 297 HHLHGPTSSSSSSPVMASWK 316


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,795,991
Number of Sequences: 37544
Number of extensions: 270430
Number of successful extensions: 484
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 479
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 484
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1011709100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).