SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0109
         (498 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_02_0631 - 12397517-12398452,12398693-12398819,12398971-123991...    64   5e-11
08_02_0098 - 12324664-12324822,12325430-12325543,12325649-123259...    61   6e-10
04_04_1357 + 32860677-32860781,32861484-32861588,32861678-328617...    57   9e-09
01_01_0994 - 7861310-7862119,7862378-7862498,7862718-7862901,786...    56   2e-08
08_02_1102 + 24319569-24319917,24320120-24321496,24321819-243220...    54   6e-08
04_04_1636 + 34951841-34954322,34954440-34954627,34955737-349558...    50   1e-06
02_03_0065 - 14629676-14629804,14631119-14631247,14631383-146317...    50   1e-06
01_06_1149 - 34901338-34901466,34901707-34901838,34901940-349022...    49   2e-06
06_03_1177 + 28174909-28175016,28176386-28176484,28177188-281772...    48   4e-06
07_03_0394 - 17633753-17636788                                         46   2e-05
03_02_0382 - 7958634-7959272,7959358-7959583,7959725-7959810,795...    45   4e-05
07_03_0036 + 12694304-12694408,12694551-12694652,12694867-126949...    44   5e-05
07_01_0062 - 457230-457339,457689-457962,458100-458195,459041-45...    44   5e-05
09_06_0108 - 20912236-20912364,20912470-20912601,20912718-209130...    44   9e-05
01_01_0186 + 1598046-1598234,1599215-1599277,1599359-1599448,159...    44   9e-05
06_03_0712 + 23803597-23803945,23804118-23805479,23805743-238058...    42   3e-04
09_04_0741 - 19852339-19852497,19853185-19853246,19853352-198534...    42   4e-04
07_03_0498 + 18786732-18786869,18788048-18788143,18788301-18788588     41   6e-04
07_01_0466 - 3518315-3521428                                           40   8e-04
07_01_0061 - 451093-451377,451501-451596,451714-451824                 40   8e-04
05_04_0073 + 17669311-17671635                                         40   0.001
02_05_0566 - 30017031-30017309,30018077-30018172,30018261-300183...    40   0.001
02_01_0739 + 5505630-5505654,5505965-5506049,5506444-5506519,550...    40   0.001
02_05_1214 + 34976814-34979813                                         37   0.010
01_07_0189 + 41875088-41875149,41875322-41875392,41875809-418759...    37   0.010
05_04_0397 - 20937280-20937386,20937494-20939681                       36   0.014
06_02_0041 + 10889741-10890092,10890161-10890235,10891139-108923...    36   0.024
03_01_0130 - 1007433-1007712,1007739-1007803,1007804-1008001,100...    36   0.024
09_02_0072 + 3895868-3895999,3897814-3897909,3898484-3898771           35   0.032
01_05_0513 - 22864657-22867899                                         35   0.032
06_03_0723 + 23875008-23875204,23875311-23875576,23877166-238772...    35   0.042
07_03_0505 + 18858406-18858522,18859860-18859955,18860760-18861047     33   0.13 
02_01_0753 - 5586705-5586766,5587864-5588056,5588154-5588423,558...    33   0.13 
03_05_0519 - 25131614-25134778                                         33   0.17 
10_08_0683 - 19860777-19861070,19861677-19861874,19862498-198626...    31   0.51 
04_04_1695 + 35433975-35437040                                         30   1.2  
07_01_1046 - 9138000-9138293,9139550-9139714,9139862-9140010,914...    29   1.6  
05_05_0149 - 22733703-22736216                                         29   1.6  
09_06_0140 + 21090686-21091645,21092142-21092221,21092705-210929...    29   2.1  
03_02_0731 - 10786122-10787018,10787859-10788449,10788659-107887...    28   3.6  
06_01_0840 + 6369046-6369672                                           27   8.4  
06_01_0228 - 1736373-1736721,1739915-1740120,1740513-1740844,174...    27   8.4  
05_05_0283 + 23833552-23833645,23833762-23833823,23834033-23834167     27   8.4  
04_04_0175 - 23307507-23308688,23308962-23309647,23310662-23310680     27   8.4  

>02_02_0631 -
           12397517-12398452,12398693-12398819,12398971-12399154,
           12399303-12399395,12400029-12400077,12400565-12400624,
           12400689-12400730,12400840-12400992,12401075-12401206,
           12401313-12401408,12401936-12402079,12402234-12402308,
           12403896-12404021
          Length = 738

 Score = 64.5 bits (150), Expect = 5e-11
 Identities = 30/73 (41%), Positives = 44/73 (60%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           VE++E  D+ P DPNGL+DP+V  +L     +R+ T +   TLNP W E F +P++    
Sbjct: 309 VEILEGADMKPSDPNGLADPYVKGHL---GPYRFQTKIHKKTLNPKWMEEFKIPVTSWAA 365

Query: 448 EDSLCLEVWDFDP 486
            + L L+V D DP
Sbjct: 366 LNLLSLQVRDKDP 378


>08_02_0098 -
           12324664-12324822,12325430-12325543,12325649-12325921,
           12326124-12326354,12326444-12326594,12326680-12326759,
           12326839-12326913,12326992-12327093,12328000-12328121,
           12329726-12329791,12330158-12330201,12330850-12330898,
           12330967-12331087,12334631-12334735
          Length = 563

 Score = 60.9 bits (141), Expect = 6e-10
 Identities = 30/75 (40%), Positives = 44/75 (58%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V V+ A DL P D  G +DPFV +YL    + +  T V + TLNP+W + F   +  
Sbjct: 435 VLSVTVISAEDLPPMDVMGKADPFVVLYLKKGETKK-KTRVVTETLNPIWNQTFDFVVED 493

Query: 439 TVNEDSLCLEVWDFD 483
            ++ D L +EVWD D
Sbjct: 494 ALH-DLLMVEVWDHD 507



 Score = 51.6 bits (118), Expect = 3e-07
 Identities = 24/73 (32%), Positives = 39/73 (53%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L V++VEA DL  KD  G SDPF  +Y+         +   +  LNP+W EH+   +  
Sbjct: 264 LLEVKLVEARDLTNKDLVGKSDPFAVLYIRPLQDKMKKSKTINNDLNPIWNEHYEFVVED 323

Query: 439 TVNEDSLCLEVWD 477
           T +   L ++++D
Sbjct: 324 T-STQRLTVKIYD 335


>04_04_1357 +
           32860677-32860781,32861484-32861588,32861678-32861728,
           32861829-32861949,32862495-32862616,32863032-32863133,
           32863226-32863300,32863391-32863470,32863601-32863751,
           32863850-32864080,32864221-32864517,32864638-32864751,
           32864857-32865030
          Length = 575

 Score = 56.8 bits (131), Expect = 9e-09
 Identities = 31/75 (41%), Positives = 43/75 (57%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V V+   DL   D NG SDP+V + L   S  +Y T V S +LNPVW + F   +  
Sbjct: 442 VLSVTVISGEDLPAMDMNGKSDPYVVLSL-KKSKTKYKTRVVSESLNPVWNQTFDFVVED 500

Query: 439 TVNEDSLCLEVWDFD 483
            ++ D L LEV+D D
Sbjct: 501 GLH-DMLMLEVYDHD 514



 Score = 48.4 bits (110), Expect = 3e-06
 Identities = 23/74 (31%), Positives = 39/74 (52%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V++V+A DL  KD  G SDPF  +Y+         +   +  LNP+W EHF   +   
Sbjct: 264 LEVKLVQARDLTNKDLIGKSDPFAIVYVRPLPDKMKRSKTINNDLNPIWNEHFEFIVE-D 322

Query: 442 VNEDSLCLEVWDFD 483
            +  ++ ++++D D
Sbjct: 323 ADTQTVTVKIYDDD 336


>01_01_0994 -
           7861310-7862119,7862378-7862498,7862718-7862901,
           7862975-7863070,7863428-7863476,7863555-7863596,
           7863684-7863836,7865631-7865705,7866462-7866587
          Length = 551

 Score = 55.6 bits (128), Expect = 2e-08
 Identities = 26/74 (35%), Positives = 44/74 (59%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           + +E++E +D+ P D NGLSDP+V   L      ++ T ++  TL+P W E F +P++  
Sbjct: 164 VKLEILEGSDMKPSDMNGLSDPYVKGRL---GPFKFQTQIQKKTLSPKWFEEFKIPITSW 220

Query: 442 VNEDSLCLEVWDFD 483
            + + L +EV D D
Sbjct: 221 ESLNELAMEVCDKD 234


>08_02_1102 +
           24319569-24319917,24320120-24321496,24321819-24322001,
           24322147-24322460,24322515-24322631,24323057-24323313,
           24323504-24323684,24323802-24324074,24324535-24324729
          Length = 1081

 Score = 54.0 bits (124), Expect = 6e-08
 Identities = 32/76 (42%), Positives = 42/76 (55%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           + LNV V+EA +L   D NG SDP+V + L      R+ T V    LNP W++ FS  + 
Sbjct: 1   MRLNVRVIEARNLRAMDSNGFSDPYVKLQL---GKQRFKTKVVKKNLNPAWDQEFSFSV- 56

Query: 436 GTVNEDSLCLEVWDFD 483
           G V  D L L V+D D
Sbjct: 57  GDV-RDVLKLYVYDED 71


>04_04_1636 +
           34951841-34954322,34954440-34954627,34955737-34955838,
           34956101-34956177,34956258-34956319,34956504-34956511
          Length = 972

 Score = 49.6 bits (113), Expect = 1e-06
 Identities = 27/74 (36%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L VEV  A DL+PKD  G +   V +        R+ T++K   LNPVW E F   +S  
Sbjct: 6   LGVEVASAHDLMPKDGQGSASACVELTF---DGQRFRTAIKDKDLNPVWNERFYFNVSDP 62

Query: 442 VNEDSLCLEVWDFD 483
            N   L LE + ++
Sbjct: 63  SNLPELALEAYVYN 76


>02_03_0065 -
           14629676-14629804,14631119-14631247,14631383-14631736,
           14631817-14632063,14632155-14632231,14632574-14632648,
           14632721-14632822,14632966-14633084,14633538-14633627,
           14634866-14635022,14635085-14635098,14635425-14635548,
           14635628-14635678,14635793-14635891,14636962-14637072
          Length = 625

 Score = 49.6 bits (113), Expect = 1e-06
 Identities = 28/75 (37%), Positives = 40/75 (53%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L+V +V A  L  KD  G SDP+V + L         TSVK   LNP W E F L +  
Sbjct: 348 ILHVNIVRAVKLTKKDFLGKSDPYVKLKLTEEKLPSKKTSVKRSNLNPEWNEDFKLVVKD 407

Query: 439 TVNEDSLCLEVWDFD 483
             ++ +L L V+D++
Sbjct: 408 PESQ-ALELTVYDWE 421


>01_06_1149 -
           34901338-34901466,34901707-34901838,34901940-34902290,
           34902301-34902619,34902756-34902784,34903641-34903715,
           34903799-34903900,34904002-34904120,34904752-34904875,
           34904976-34905026,34905143-34905241,34905751-34905861
          Length = 546

 Score = 49.2 bits (112), Expect = 2e-06
 Identities = 28/82 (34%), Positives = 47/82 (57%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           R  G++L V+V+ A +L  KD  G SDP+V + +  +      T+VK G LNP W E F 
Sbjct: 241 RPVGILL-VKVLRAQNLQKKDLLGKSDPYVKLTMSDDKLPSKKTTVKRGNLNPEWNEDFK 299

Query: 424 LPMSGTVNEDSLCLEVWDFDPA 489
             ++    ++ L ++V+D++ A
Sbjct: 300 FVVTDPETQE-LEIKVFDWEQA 320


>06_03_1177 +
           28174909-28175016,28176386-28176484,28177188-28177238,
           28177394-28177517,28177765-28177883,28177954-28178055,
           28178124-28178198,28178390-28178466,28178920-28179169,
           28179311-28179664,28179807-28179941,28180097-28180225
          Length = 540

 Score = 48.0 bits (109), Expect = 4e-06
 Identities = 22/54 (40%), Positives = 31/54 (57%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           +L+V+V+ A +L+  D  G SDP+V + L         TS+K   LNP W EHF
Sbjct: 261 ILHVKVIRAMNLLKMDLLGKSDPYVKLRLSGEKLPSKKTSIKMSNLNPEWNEHF 314


>07_03_0394 - 17633753-17636788
          Length = 1011

 Score = 45.6 bits (103), Expect = 2e-05
 Identities = 24/62 (38%), Positives = 34/62 (54%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLP 429
           S L L VEV  A DL+PK+  G  +P+V I        ++ T++K   +NPVW E F   
Sbjct: 3   SNLKLGVEVTSAHDLLPKE-QGTCNPYVEIEF---DDQKFRTAIKERDINPVWNEQFYFN 58

Query: 430 MS 435
           +S
Sbjct: 59  IS 60


>03_02_0382 -
           7958634-7959272,7959358-7959583,7959725-7959810,
           7959909-7959989,7960102-7960200,7960348-7960466,
           7960557-7960677,7960831-7960881,7961041-7961142,
           7962610-7962717,7962877-7962962,7963353-7963449
          Length = 604

 Score = 44.8 bits (101), Expect = 4e-05
 Identities = 29/74 (39%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V VV A  L  K+  G SDP+V +Y+      +  TSV    LNP W E FSL ++  
Sbjct: 327 LTVTVVRAESLKNKELIGKSDPYVVLYI--RPMFKEKTSVIDDNLNPEWNETFSL-IAED 383

Query: 442 VNEDSLCLEVWDFD 483
                L L+V+D D
Sbjct: 384 KETQHLILQVFDED 397


>07_03_0036 +
           12694304-12694408,12694551-12694652,12694867-12694947,
           12696475-12696525,12697308-12697473,12698759-12698877,
           12698975-12699073,12699684-12699764,12699845-12699927,
           12701177-12701402,12704272-12704439,12706408-12706800
          Length = 557

 Score = 44.4 bits (100), Expect = 5e-05
 Identities = 28/74 (37%), Positives = 38/74 (51%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V VV+AT L  K+  G SDP+V +Y+      +  T V    LNP W E F L +   
Sbjct: 306 LTVTVVKATSLKNKELIGKSDPYVILYV--RPMFKVKTKVIDDNLNPEWNETFPLIVEDK 363

Query: 442 VNEDSLCLEVWDFD 483
             + S+  EV+D D
Sbjct: 364 ETQ-SVIFEVYDED 376


>07_01_0062 -
           457230-457339,457689-457962,458100-458195,459041-459151
          Length = 196

 Score = 44.4 bits (100), Expect = 5e-05
 Identities = 27/74 (36%), Positives = 40/74 (54%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L+V V+   +LV +D  G SDP+V ++L    + +  T V   T NPVW E  +L +   
Sbjct: 8   LSVRVLRGVNLVSRDAGG-SDPYVVLHL---DNQKLKTGVVKKTTNPVWNEELTLAVRNP 63

Query: 442 VNEDSLCLEVWDFD 483
             E  + LEV+D D
Sbjct: 64  --ETPIQLEVFDKD 75


>09_06_0108 -
           20912236-20912364,20912470-20912601,20912718-20913071,
           20913161-20913407,20913489-20913565,20913971-20914045,
           20914118-20914219,20914329-20914447,20914861-20914984,
           20915081-20915131,20915247-20915345,20915839-20915949
          Length = 539

 Score = 43.6 bits (98), Expect = 9e-05
 Identities = 25/77 (32%), Positives = 43/77 (55%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           G++L V+V+ A +L  KD  G SDP+V + +  +      T+VK   LNP W E F   +
Sbjct: 260 GILL-VKVLRAQNLRKKDLLGKSDPYVKLKMSDDKLPSKKTTVKRSNLNPEWNEDFKFVV 318

Query: 433 SGTVNEDSLCLEVWDFD 483
           +    + +L + V+D++
Sbjct: 319 TDPETQ-ALEINVFDWE 334


>01_01_0186 +
           1598046-1598234,1599215-1599277,1599359-1599448,
           1599968-1600093,1600583-1600726,1600845-1601255,
           1601283-1601364,1601403-1601491,1602250-1602471,
           1602552-1602827,1603116-1603253,1603772-1604077,
           1604203-1604421
          Length = 784

 Score = 43.6 bits (98), Expect = 9e-05
 Identities = 21/65 (32%), Positives = 33/65 (50%)
 Frame = +1

Query: 244 RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFS 423
           R     + + ++EA DL+  D  G SDP+V ++     S +  T V   TL+P W + F 
Sbjct: 569 RVEATWIELVIIEARDLIAADLRGTSDPYVRVHY---GSKKKRTKVVYKTLSPDWNQTFE 625

Query: 424 LPMSG 438
            P +G
Sbjct: 626 FPETG 630



 Score = 32.7 bits (71), Expect = 0.17
 Identities = 19/57 (33%), Positives = 24/57 (42%)
 Frame = +1

Query: 250 SGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           +G  L V VVE   L     +G  DP+V +         Y T   S T  PVW + F
Sbjct: 439 TGRKLRVAVVEGKALAVNGKSGKCDPYVKV---QYGKALYKTKTLSHTTRPVWNDKF 492


>06_03_0712 +
           23803597-23803945,23804118-23805479,23805743-23805811,
           23806050-23806330,23806817-23807076,23807521-23807689,
           23807796-23808068,23808251-23808499
          Length = 1003

 Score = 41.9 bits (94), Expect = 3e-04
 Identities = 26/66 (39%), Positives = 34/66 (51%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           + L V VVEA  L     +G SDPFV + L      R  T+V   TL P W+E FS  + 
Sbjct: 1   MKLQVRVVEARGLPAVRVDGTSDPFVKLQL---GKRRAKTAVARRTLAPAWDEEFSF-LV 56

Query: 436 GTVNED 453
           G + E+
Sbjct: 57  GDIAEE 62


>09_04_0741 -
           19852339-19852497,19853185-19853246,19853352-19853415,
           19853561-19853614,19853744-19853890,19854460-19854564,
           19854651-19854794,19854987-19855093,19855613-19855712,
           19855804-19855833,19856492-19856608,19856705-19856828,
           19857143-19857189,19857272-19857400,19857777-19857852,
           19858446-19858543,19858630-19858671,19858811-19859044
          Length = 612

 Score = 41.5 bits (93), Expect = 4e-04
 Identities = 25/94 (26%), Positives = 46/94 (48%)
 Frame = +1

Query: 217 ATSYQSGG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTL 396
           A  Y+ G    S  ++ +E++ A +L+  + NG SDP+  I        R+++ V  G+ 
Sbjct: 76  ADKYKGGSSGPSAYVVKLELLAAKNLIAANLNGTSDPYALI--TCGEEKRFSSMVP-GSR 132

Query: 397 NPVWEEHFSLPMSGTVNEDSLCLEVWDFDPAETV 498
           NP+W E F+  +     + ++ +  WD     TV
Sbjct: 133 NPMWGEEFNFFVDSLPVKINVTIYDWDIVWKSTV 166


>07_03_0498 + 18786732-18786869,18788048-18788143,18788301-18788588
          Length = 173

 Score = 40.7 bits (91), Expect = 6e-04
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDP-NGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           LNV VV  ++L+  DP    SDP+V   ++S    +  TSV+    NPVW E   L ++ 
Sbjct: 15  LNVRVVRGSNLIIADPLTHTSDPYV---VLSYGPQKVKTSVQKKNSNPVWNEVLQLAVTN 71

Query: 439 TVNEDSLCLEVWDFD 483
                 + LEV+D D
Sbjct: 72  PTK--PVKLEVFDED 84


>07_01_0466 - 3518315-3521428
          Length = 1037

 Score = 40.3 bits (90), Expect = 8e-04
 Identities = 22/63 (34%), Positives = 28/63 (44%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L VEVVEA +L+PKD  G S P+  +        R  T      LNP W E      +G 
Sbjct: 10  LVVEVVEARNLLPKDGTGTSSPYARV---DFDGQRRKTHTVPRELNPAWNEALEFNFAGV 66

Query: 442 VNE 450
             +
Sbjct: 67  AGD 69


>07_01_0061 - 451093-451377,451501-451596,451714-451824
          Length = 163

 Score = 40.3 bits (90), Expect = 8e-04
 Identities = 20/62 (32%), Positives = 33/62 (53%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +L + VV   +L  +D  G SDP+V + L      +  TSVK  ++NP+W E  +L +  
Sbjct: 7   LLKIRVVRGINLAYRDTRG-SDPYVVLRL---GKQKVKTSVKKKSVNPIWHEELTLSIMN 62

Query: 439 TV 444
            +
Sbjct: 63  PI 64


>05_04_0073 + 17669311-17671635
          Length = 774

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 26/72 (36%), Positives = 36/72 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V V+EA DL+P D     D +V   ++ N + R   S  S TLNP+W E     ++  
Sbjct: 203 LRVNVIEAQDLIPNDRTRFPDVYVKA-MLGNQALRTRVS-PSRTLNPMWNEDLMF-VAAE 259

Query: 442 VNEDSLCLEVWD 477
             E+ L L V D
Sbjct: 260 PFEEHLILSVED 271


>02_05_0566 -
           30017031-30017309,30018077-30018172,30018261-30018377,
           30018538-30018667,30018866-30019029,30019480-30019485
          Length = 263

 Score = 39.9 bits (89), Expect = 0.001
 Identities = 29/74 (39%), Positives = 37/74 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           LN+ VV    L  +D    SDP+V + L      +  T+VK   LNPVW E   L +S  
Sbjct: 110 LNITVVRGIQLAVRDML-TSDPYVVLTL---GEQKAQTTVKPSDLNPVWNE--VLKISIP 163

Query: 442 VNEDSLCLEVWDFD 483
            N   L LEV+D D
Sbjct: 164 RNYGPLKLEVYDHD 177


>02_01_0739 +
           5505630-5505654,5505965-5506049,5506444-5506519,
           5506694-5506857,5506878-5506935,5507283-5507399,
           5507543-5507638,5507905-5508186
          Length = 300

 Score = 39.5 bits (88), Expect = 0.001
 Identities = 28/75 (37%), Positives = 39/75 (52%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           +LNV+V   T+L  +D +  SDP+V + L      +  TSV    LNPVW E   L +S 
Sbjct: 145 ILNVKVKGGTNLAIRDMSS-SDPYVVLTL---GQQKAQTSVIKANLNPVWNE--ELKLSV 198

Query: 439 TVNEDSLCLEVWDFD 483
                 L L+V+D D
Sbjct: 199 PQQYGPLKLQVFDHD 213


>02_05_1214 + 34976814-34979813
          Length = 999

 Score = 36.7 bits (81), Expect = 0.010
 Identities = 21/51 (41%), Positives = 26/51 (50%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L VEVV A +L+PKD  G S  +V +        R  T  +   LNPVW E
Sbjct: 8   LVVEVVAAHNLMPKDGQGSSSAYVEVEF---EHQRRRTRARPKELNPVWNE 55


>01_07_0189 +
           41875088-41875149,41875322-41875392,41875809-41875902,
           41876285-41876360,41877130-41877293,41877428-41877605,
           41877687-41877809,41877895-41877990,41878091-41878372
          Length = 381

 Score = 36.7 bits (81), Expect = 0.010
 Identities = 26/79 (32%), Positives = 38/79 (48%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
           ++ V V+  T+L  +D    SDP+V + L   S     T V   +LNPVW E   L +  
Sbjct: 226 LIKVNVIRGTNLAVRDMMS-SDPYVILNLGHQSM---KTKVIKSSLNPVWNERILLSIPD 281

Query: 439 TVNEDSLCLEVWDFDPAET 495
            +    L L+V+D D   T
Sbjct: 282 PI--PMLKLQVYDKDTFTT 298


>05_04_0397 - 20937280-20937386,20937494-20939681
          Length = 764

 Score = 36.3 bits (80), Expect = 0.014
 Identities = 21/63 (33%), Positives = 30/63 (47%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGT 441
           L V  + A DLVP D +  ++  V + L +    R       GTLNP+W E F   +S  
Sbjct: 236 LRVAAIGAQDLVPLDASRPANFCVKLQL-AGQVRRTRPGAPPGTLNPIWNEEFMFVVSEP 294

Query: 442 VNE 450
            +E
Sbjct: 295 FDE 297


>06_02_0041 +
           10889741-10890092,10890161-10890235,10891139-10892341,
           10892970-10893253,10893343-10893459,10894126-10894388,
           10894557-10894725,10894838-10895110,10895674-10895718,
           10896472-10896591,10896926-10896987,10897296-10897318,
           10897911-10898128
          Length = 1067

 Score = 35.5 bits (78), Expect = 0.024
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNG-LSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           + L V+V EA +L   D  G LSDP+  + L      R  T V   TL+P W+E F+  +
Sbjct: 1   MRLLVQVSEARNLPAIDGGGGLSDPYAKLQL---GRQRGKTRVAKRTLSPTWDEEFAFRV 57

Query: 433 SGTVNEDSLCLEVWDFD 483
                +D L + V D D
Sbjct: 58  VDL--KDELVVVVVDED 72


>03_01_0130 -
           1007433-1007712,1007739-1007803,1007804-1008001,
           1008103-1008273,1008405-1008553,1008780-1008927,
           1009015-1009083,1009168-1009416,1009516-1009710,
           1009869-1009985,1010205-1011329
          Length = 921

 Score = 35.5 bits (78), Expect = 0.024
 Identities = 17/39 (43%), Positives = 25/39 (64%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           SDP+VT+ L S +  R  T V +   NPVW +HF +P++
Sbjct: 141 SDPYVTVQLASATVAR--TYVVNDDENPVWAQHFLIPVA 177


>09_02_0072 + 3895868-3895999,3897814-3897909,3898484-3898771
          Length = 171

 Score = 35.1 bits (77), Expect = 0.032
 Identities = 26/85 (30%), Positives = 39/85 (45%)
 Frame = +1

Query: 229 QSGG*RASGLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVW 408
           +  G R    +L V V   T+L  +D    SDP+V + L + +     T V +  LNPVW
Sbjct: 4   EEAGVRERRGVLKVVVASGTNLAVRDFTS-SDPYVVVRLAAMNK---KTKVINSCLNPVW 59

Query: 409 EEHFSLPMSGTVNEDSLCLEVWDFD 483
            E  S  +        +  EV+D+D
Sbjct: 60  NEEMSFSIEEPAG--VIKFEVFDWD 82


>01_05_0513 - 22864657-22867899
          Length = 1080

 Score = 35.1 bits (77), Expect = 0.032
 Identities = 21/51 (41%), Positives = 24/51 (47%)
 Frame = +1

Query: 262 LNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEE 414
           L VEVV+A DLVPKD  G S  F  +        R  T      L+P W E
Sbjct: 27  LAVEVVDARDLVPKDGLGTSSAFAVV---DFDGQRKRTRTVPRDLSPQWHE 74


>06_03_0723 + 23875008-23875204,23875311-23875576,23877166-23877274,
            23877577-23878212,23878328-23878573,23878669-23878834,
            23878863-23879076,23879580-23880097,23880617-23880683,
            23882131-23882215,23882292-23882367,23882593-23882756,
            23883088-23883217,23883314-23883430,23883505-23883600,
            23883732-23884009,23886571-23886794,23886935-23887011,
            23887103-23887145,23887231-23887288,23888371-23888410,
            23888891-23889418
          Length = 1444

 Score = 34.7 bits (76), Expect = 0.042
 Identities = 25/75 (33%), Positives = 36/75 (48%)
 Frame = +1

Query: 259  MLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSG 438
            ++ V+V+  T L  +D    SDP+V + L      +  T V    LNPVW E   L +S 
Sbjct: 967  IIKVKVIRGTKLAVRDILS-SDPYVVLTL---GQQKAKTKVIKSNLNPVWNE--VLTLSV 1020

Query: 439  TVNEDSLCLEVWDFD 483
                  L L+V+D D
Sbjct: 1021 PQKYGPLKLQVYDHD 1035


>07_03_0505 + 18858406-18858522,18859860-18859955,18860760-18861047
          Length = 166

 Score = 33.1 bits (72), Expect = 0.13
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 1/76 (1%)
 Frame = +1

Query: 259 MLNVEVVEATDLVPKDP-NGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           +L V V+   +L   DP    SDP+V   ++ + S +  +S++  ++NP W E  +L ++
Sbjct: 7   LLKVRVMRGLNLAICDPLTHSSDPYV---VLRHGSQKVKSSIRYHSINPEWNEELTLSIT 63

Query: 436 GTVNEDSLCLEVWDFD 483
             +    + +EV+D D
Sbjct: 64  NMML--PVKIEVFDKD 77


>02_01_0753 -
           5586705-5586766,5587864-5588056,5588154-5588423,
           5588522-5588687,5589049-5589209,5590065-5590181,
           5590269-5590549,5590750-5590833,5591100-5592542,
           5593167-5593575
          Length = 1061

 Score = 33.1 bits (72), Expect = 0.13
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           + L V V+EA  L      G SDP+V + +      R  T+V    L+P+W+E F   + 
Sbjct: 21  MRLCVHVLEARGLQAAYLTGHSDPYVRLQM---GRRRAKTTVVKRCLSPLWDEEFGFAVG 77

Query: 436 GTVNE 450
               E
Sbjct: 78  DAEEE 82


>03_05_0519 - 25131614-25134778
          Length = 1054

 Score = 32.7 bits (71), Expect = 0.17
 Identities = 19/72 (26%), Positives = 32/72 (44%)
 Frame = +1

Query: 268 VEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           VEV  A +L+PKD  G +  +  +        R  T+ +   LNP W E     +    +
Sbjct: 12  VEVCNARNLMPKDGQGTASAYAVV---DFDGQRRRTATRPRDLNPQWGERLEFLVH---D 65

Query: 448 EDSLCLEVWDFD 483
            D++C E  + +
Sbjct: 66  PDAMCAETLELN 77


>10_08_0683 -
           19860777-19861070,19861677-19861874,19862498-19862659,
           19862763-19862911,19863089-19863236,19863317-19863385,
           19863471-19863719,19863937-19864131,19864444-19864560,
           19864978-19866537
          Length = 1046

 Score = 31.1 bits (67), Expect = 0.51
 Identities = 19/60 (31%), Positives = 29/60 (48%)
 Frame = +1

Query: 253 GLMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPM 432
           G +L   ++ A        N  SDP+VTI +   +  R  T V     NPVW ++F +P+
Sbjct: 264 GDLLGPRLIGAVGSKMSSANMTSDPYVTIQVSYATVAR--TYVVPNNENPVWTQNFLVPV 321


>04_04_1695 + 35433975-35437040
          Length = 1021

 Score = 29.9 bits (64), Expect = 1.2
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVW 408
           + + VE+++A++L PKD  G  + FV +        +  T  K    +P W
Sbjct: 1   MKVGVEILDASELAPKDGAGACNAFVEVEF---DGQKQRTPTKPADRSPQW 48



 Score = 27.9 bits (59), Expect = 4.8
 Identities = 14/55 (25%), Positives = 24/55 (43%)
 Frame = +1

Query: 256 LMLNVEVVEATDLVPKDPNGLSDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHF 420
           + L V  + A DL+P +      P +    +   + R  +    G+ NP+W E F
Sbjct: 451 IYLKVVAIAAQDLIPAEKGRPLAPSIVKIQLGGQTRRTRSQ---GSANPMWNEEF 502


>07_01_1046 -
           9138000-9138293,9139550-9139714,9139862-9140010,
           9140363-9140510,9140659-9140727,9140827-9141087,
           9141498-9141692,9142932-9143048,9143701-9144477
          Length = 724

 Score = 29.5 bits (63), Expect = 1.6
 Identities = 14/43 (32%), Positives = 27/43 (62%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTVN 447
           SDP+V++ L   +  +  T V + + NP W+EHF + ++ +V+
Sbjct: 67  SDPYVSVCLSGATVAQ--TRVIANSENPKWDEHFYVQVAHSVS 107


>05_05_0149 - 22733703-22736216
          Length = 837

 Score = 29.5 bits (63), Expect = 1.6
 Identities = 12/28 (42%), Positives = 19/28 (67%)
 Frame = -3

Query: 454 NLHSQCQTWVKKNVLPKQDLEFPTSPMC 371
           +L++  Q W++KNVL K +LE   S +C
Sbjct: 680 DLNTDLQVWIEKNVLLKGELENRFSSLC 707


>09_06_0140 +
           21090686-21091645,21092142-21092221,21092705-21092906,
           21093052-21093327,21093414-21093482,21093638-21093785,
           21094080-21094228,21094897-21095061,21095623-21095732,
           21095868-21095946,21095947-21096240
          Length = 843

 Score = 29.1 bits (62), Expect = 2.1
 Identities = 14/39 (35%), Positives = 23/39 (58%)
 Frame = +1

Query: 319 SDPFVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMS 435
           SDP+VT+ +      R  T V     +PVW+E F++P++
Sbjct: 78  SDPYVTLSVAGAVVAR--TRVIPNDQDPVWDERFAVPLA 114


>03_02_0731 -
           10786122-10787018,10787859-10788449,10788659-10788740,
           10789914-10790107
          Length = 587

 Score = 28.3 bits (60), Expect = 3.6
 Identities = 13/39 (33%), Positives = 21/39 (53%)
 Frame = +1

Query: 328 FVTIYLMSNSSHRYNTSVKSGTLNPVWEEHFSLPMSGTV 444
           F  + LM N +     +V +  +  V+E HF +PM+G V
Sbjct: 78  FFLLMLMGNGNLPNPVAVIAPNIPAVYEAHFGVPMAGAV 116


>06_01_0840 + 6369046-6369672
          Length = 208

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 1/39 (2%)
 Frame = -1

Query: 255 PGGSLA-SALVRSCVCLSLPILNASCTYDSIACCPTSQP 142
           P GS   S L+ +   L  PI+  S  YD +A  PT+QP
Sbjct: 146 PAGSFDWSQLMANSPPLYSPIVIGSHAYDDLAVWPTTQP 184


>06_01_0228 -
           1736373-1736721,1739915-1740120,1740513-1740844,
           1740935-1741499
          Length = 483

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = -3

Query: 271 RHSASTRRLFSLRFGKKLRVFIIAYFKCFLH 179
           RH  +  RLF L    ++R F+I  F C  H
Sbjct: 352 RHHRTWDRLFRLFTRNRMRTFLIEAFMCHTH 382


>05_05_0283 + 23833552-23833645,23833762-23833823,23834033-23834167
          Length = 96

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = -1

Query: 243 LASALVRSCVCLSLPILNASCTYDSIACCPTSQPTSHPPTL 121
           L + L  SC+ L LP+L +S    S +   +SQ   HPP+L
Sbjct: 8   LVAVLALSCLLLLLPLLVSSVPM-SRSLHLSSQQQQHPPSL 47


>04_04_0175 - 23307507-23308688,23308962-23309647,23310662-23310680
          Length = 628

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = +1

Query: 352 NSSHRYNTSVKSGTLNPVWEEHFSLP 429
           N  + YN  +  G+L   WE  +SLP
Sbjct: 287 NQINHYNPFIAYGSLEDTWEPKYSLP 312


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,804,366
Number of Sequences: 37544
Number of extensions: 273357
Number of successful extensions: 792
Number of sequences better than 10.0: 44
Number of HSP's better than 10.0 without gapping: 764
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 782
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1047416480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).