SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0106
         (711 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_1147 - 24688686-24689729,24689875-24690036,24690339-246903...    34   0.13 
05_01_0054 + 379974-380215,380343-380556,381603-381892,382384-38...    32   0.39 
04_04_0647 - 26928244-26928535,26931321-26931454,26932278-26933414     31   0.68 
12_01_0796 + 7292523-7292783,7292963-7293018,7295274-7295331,729...    29   3.6  
03_04_0090 + 17228253-17228403,17229062-17229129,17229238-172309...    29   3.6  
01_01_0047 + 334809-334877,334966-335074,335159-335299,336337-33...    29   3.6  
08_01_0132 + 1055977-1056483,1058083-1058186,1058330-1058385,105...    29   4.8  
12_02_0877 - 23946449-23948284                                         28   8.4  
12_01_0655 + 5546293-5546478,5546760-5546877,5550697-5550776,555...    28   8.4  
08_02_1002 + 23439642-23440046,23440558-23440761,23440874-234409...    28   8.4  
05_04_0196 - 18964927-18965218,18965337-18965503,18966182-189663...    28   8.4  
04_04_0433 + 25163111-25163471,25163943-25164154,25164420-251647...    28   8.4  
01_04_0113 - 16133794-16134933,16135030-16135611,16135698-16135853     28   8.4  

>08_02_1147 -
           24688686-24689729,24689875-24690036,24690339-24690368,
           24690713-24690860,24691302-24691489
          Length = 523

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = -2

Query: 545 RSRTKRNRHDLRQEDPRKAGERGSGSSPKRK 453
           +SR  R RHD   E+PR+  +R     PKR+
Sbjct: 289 KSRKDRRRHDSEDEEPRRKHQRSEDDEPKRR 319


>05_01_0054 + 379974-380215,380343-380556,381603-381892,382384-382560,
            382705-383481,383572-383645,383757-383819,383919-384007,
            384106-384201,384319-384978,385613-385687,386422-386492,
            386578-386635,386900-387104,387379-387869
          Length = 1193

 Score = 32.3 bits (70), Expect = 0.39
 Identities = 18/44 (40%), Positives = 23/44 (52%)
 Frame = -2

Query: 587  VLS*PLNGGRTESCRSRTKRNRHDLRQEDPRKAGERGSGSSPKR 456
            VLS PL    T+S    TK N+ D  +E  R A  +GSG+   R
Sbjct: 1016 VLSAPLPSSGTKSTEGGTKWNKCDREREHSRDASAKGSGTKSGR 1059


>04_04_0647 - 26928244-26928535,26931321-26931454,26932278-26933414
          Length = 520

 Score = 31.5 bits (68), Expect = 0.68
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = -2

Query: 263 QFATSLTYIILSTRGSSPWRPAADMGTNRRDISTYIPHLNFQGPQRVSG 117
           QF   + + +L+ RG  P +PAA     RRD   ++P  + Q P    G
Sbjct: 21  QFHLKVLHAVLAVRGPRPLQPAASASFRRRDRWFHLPLHDPQPPPAAEG 69


>12_01_0796 +
           7292523-7292783,7292963-7293018,7295274-7295331,
           7295777-7295843,7296461-7296516,7296638-7296691,
           7296836-7296961
          Length = 225

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = -1

Query: 354 TRPGTGPHPLPVQTRHAPVLRANPYSEVTDPICHFPYLHYSI 229
           T+P +  H L +  RH P L+A P S +    C  P +  +I
Sbjct: 100 TKPLSTGHSLIIPKRHFPSLQATPPSVIAAICCKLPLISSAI 141


>03_04_0090 +
           17228253-17228403,17229062-17229129,17229238-17230902,
           17231002-17231143,17231648-17232399
          Length = 925

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = -1

Query: 333 HPLPVQTRHAPVLRANP 283
           H +PVQ  H+PVL+ NP
Sbjct: 340 HSVPVQKNHSPVLKTNP 356


>01_01_0047 + 334809-334877,334966-335074,335159-335299,336337-336498,
            336577-336734,337180-337310,337385-337472,337587-337690,
            338346-338444,339060-339116,339262-339337,339519-339602,
            339969-340010,340128-340198,341516-341564,342370-342441,
            343149-343286,343393-343473,344166-344353,344591-345188,
            345274-345342,346729-346854,347048-347175,347986-348142,
            348342-348388,348472-348535,348691-348765,349292-349414,
            349797-349982,351179-351303,351390-351459,351974-352101,
            352585-352726,353065-353163,353239-353285,353598-353652,
            353758-353967,354686-354757,354836-354905,355231-355414,
            355521-355644,355732-355863,356252-356317,356805-356852,
            357572-357676,357728-357865,358097-358399,358482-358594,
            359082-359148,359236-359310,359395-359517,359610-359618,
            360156-360320,360401-360502,361545-361696,361794-361995,
            362079-362126,362215-362298,362613-362657,363302-363385,
            363890-363970,364044-364133,364217-364279,364824-364841,
            365238-365378,365494-365550,366091-366185,366275-366383,
            367067-367156,367308-367387,367480-367558,367742-367903,
            368005-368136,368335-368469,368553-368618,369317-369457,
            369575-369648,369685-369910
          Length = 2905

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 15/45 (33%), Positives = 28/45 (62%)
 Frame = -1

Query: 624  F*LDSRIPLVRASSELTVERRSYRIVPIAHETKPTRLTAGRSAEG 490
            F L SR  +V+A  + T E +SY+ +P+ ++   +RL + + A+G
Sbjct: 2302 FSLFSREQVVKAMMKTTKEVQSYKFIPLVYQI-ASRLGSSKDAQG 2345


>08_01_0132 +
           1055977-1056483,1058083-1058186,1058330-1058385,
           1058534-1058688,1058842-1058955,1059207-1059449
          Length = 392

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 17/54 (31%), Positives = 25/54 (46%)
 Frame = -2

Query: 374 NITHEHRPDPAPVRIRFPSKPDTPRSSEPILIPKLRIQFATSLTYIILSTRGSS 213
           ++ H H   P+P R   P  P    +S PI  P + +  A  +T I L T  S+
Sbjct: 108 SVRHYHYYPPSPTRSSSPPTPAAHTTSCPI-CPYVLLAAAVGITIIFLCTLASN 160


>12_02_0877 - 23946449-23948284
          Length = 611

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = -3

Query: 337 SASASRPNPTRPGPQSQSLFRSYGSNLPLPLP 242
           SASA RP PT   P  + L   + ++LP  LP
Sbjct: 10  SASAVRPPPTWGAPSQRRLVEQHLASLPRGLP 41


>12_01_0655 +
           5546293-5546478,5546760-5546877,5550697-5550776,
           5551329-5552345,5552523-5553344,5553528-5553800
          Length = 831

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = +3

Query: 555 CTTAVQRSAQNWHGQGESDCLIKTKHCDGPRGC*RNVISAQCS 683
           C T   RS  N H   +  CL+  +H     G   NVI  +CS
Sbjct: 242 CDTERARSDTNEHNIYDGCCLLDVQHTQSFPGNGANVIPTKCS 284


>08_02_1002 +
           23439642-23440046,23440558-23440761,23440874-23440990,
           23441116-23441511,23441586-23441938,23442067-23442187,
           23442602-23442781,23442813-23442896,23444398-23444523,
           23445286-23445588
          Length = 762

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = -3

Query: 388 NSLKRT*RTNIDQTRHRSASASRPNPTRPGPQSQS-LFRSYGSNLPLPLPTL 236
           +SLKR   TN+ QT  R+  +      RPG ++QS    S+  +   PL T+
Sbjct: 310 SSLKRV--TNVKQTPRRTIPSMNHGGDRPGKENQSCTTNSFRDHSRFPLKTV 359


>05_04_0196 -
           18964927-18965218,18965337-18965503,18966182-18966328,
           18966419-18966650,18968087-18968241
          Length = 330

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = -2

Query: 524 RHDLRQEDPRKAGERGSGSSPKRKTIFASVILNIYSF*GRIILKY*LAKTNI 369
           +  L Q   RK  E G GSSP   + F++ +L   S     IL Y L +  +
Sbjct: 186 KQKLIQRQRRKNAEAGGGSSPVALSAFSAFLLGAISKSVATILTYPLIRCKV 237


>04_04_0433 +
           25163111-25163471,25163943-25164154,25164420-25164701,
           25164794-25164916,25165511-25165664,25165754-25165965,
           25166143-25166212,25166294-25166424
          Length = 514

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%)
 Frame = +3

Query: 555 CTTAVQRSAQNWHGQGESDCLIKTKHCDGPRGC-*RNVISAQCS 683
           CT++ +R A  W G G    L    HC  P       V+S +CS
Sbjct: 26  CTSSSRRRASPWGGAGRLIRLRLRGHCPSPASARAARVVSPRCS 69


>01_04_0113 - 16133794-16134933,16135030-16135611,16135698-16135853
          Length = 625

 Score = 27.9 bits (59), Expect = 8.4
 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%)
 Frame = -1

Query: 195 GYGYEPARHLHVHPSPEFSRSAES-IRTPPQMRCSSRSEPYLPSI 64
           G+   P+ H    P P+      S  R PP  R S RSE   P +
Sbjct: 26  GFDVTPSPHAEPSPRPQLRHDNPSRSRVPPLERVSRRSEVVFPPL 70


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,218,498
Number of Sequences: 37544
Number of extensions: 536912
Number of successful extensions: 2033
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1920
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2032
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1839213168
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).