SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0105
         (697 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_05_0706 + 24457148-24458031,24458621-24458822,24458896-244590...    31   0.66 
02_01_0083 - 566201-567127,567223-567464,567623-567880,568173-56...    30   2.0  
06_03_1055 - 27234824-27234838,27236087-27236125,27236322-272373...    29   2.7  
03_05_0183 - 21681673-21682524                                         29   2.7  
05_07_0294 - 29038259-29038420,29038526-29038632,29038889-290390...    29   3.5  
01_07_0197 + 41912207-41912652,41913226-41913800,41913828-419157...    29   3.5  

>01_05_0706 +
           24457148-24458031,24458621-24458822,24458896-24459080,
           24459170-24459503,24459614-24459818,24460022-24460128,
           24460220-24460381
          Length = 692

 Score = 31.5 bits (68), Expect = 0.66
 Identities = 24/69 (34%), Positives = 33/69 (47%), Gaps = 4/69 (5%)
 Frame = -3

Query: 626 SKWASTSRLAF*MRNATSKVTLFRASRLSGLHSEHILAGLARLASAL----EAFRHNPAD 459
           ++W    + A  +R+    V L   S     +    LAGL RLA AL    EA R +PA+
Sbjct: 223 NEWYKKGKHAEALRHYDRAVALCPESAACRGNRAAALAGLGRLADALRDCEEAVRLDPAN 282

Query: 458 GSSHHRPLG 432
           G +H R  G
Sbjct: 283 GRAHSRLAG 291


>02_01_0083 -
           566201-567127,567223-567464,567623-567880,568173-568298,
           568420-568489
          Length = 540

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)
 Frame = +1

Query: 451 ELPSAGLCLNASKAEASL-ANPARICSLWSPESREALNNVTLLVAFRIQNARRDVEA 618
           ELP   L     + E  + A+ AR C  W PESR  ++ V  ++A    ++R+   A
Sbjct: 427 ELPDPALQGRFPQEEMQIMAHLARECLQWEPESRPTMSEVVQILATIAPSSRKHAAA 483


>06_03_1055 -
           27234824-27234838,27236087-27236125,27236322-27237388,
           27237422-27237630,27237650-27238053
          Length = 577

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 15/46 (32%), Positives = 27/46 (58%)
 Frame = +3

Query: 492 RSQPSQSGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGS 629
           R+  + +GK +   E  E   S+QCD T  + +S RE ++R+P+ +
Sbjct: 429 RAAAAAAGKPISEHEAIEHLWSRQCDLTEILQNSSRE-KKRNPYAA 473


>03_05_0183 - 21681673-21682524
          Length = 283

 Score = 29.5 bits (63), Expect = 2.7
 Identities = 18/47 (38%), Positives = 26/47 (55%)
 Frame = +1

Query: 199 SQAFIATLLFDPSMSALPILRTNIRQALDCSPIKRERELGLDRRETG 339
           SQAF A LL D + +A+P++    R A + +  + E E    RR TG
Sbjct: 229 SQAFSAVLLADANRAAIPVVVVQKRPAPE-TETETEEEPPRQRRRTG 274


>05_07_0294 -
           29038259-29038420,29038526-29038632,29038889-29039093,
           29039173-29039536,29039588-29039772,29039879-29040080,
           29040697-29041589
          Length = 705

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 4/66 (6%)
 Frame = -3

Query: 626 SKWASTSRLAF*MRNATSKVTLFRASRLSGLHSEHILAGLARLASAL----EAFRHNPAD 459
           ++W         +R+    V L   S     +    L GL RLA AL    EA R +PA 
Sbjct: 226 NEWYKKGHYGEALRHYDQAVALCPDSAACRSNRAAALIGLGRLAEALRECEEAIRRDPAS 285

Query: 458 GSSHHR 441
           G +H R
Sbjct: 286 GRAHSR 291


>01_07_0197 +
           41912207-41912652,41913226-41913800,41913828-41915748,
           41915836-41916049,41916143-41916394,41916469-41916528,
           41916646-41916776,41916898-41917012,41917084-41917239
          Length = 1289

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +3

Query: 138 YKEFLARG-ARKVTTGITGLWQPSVHSDVAF*SFDVG 245
           YK F A G  RKV  GIT  + PS+  D+AF S  +G
Sbjct: 633 YKIFQAFGLVRKVEKGITRWYYPSMLDDLAFDSAALG 669


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,734,450
Number of Sequences: 37544
Number of extensions: 420229
Number of successful extensions: 1181
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1150
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1180
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1780264028
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).