SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0103
         (685 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_01_0037 + 261405-261779,261880-262065,262185-262271,262341-26...    29   4.5  
06_03_0312 - 19471670-19471874,19472608-19472807                       28   6.0  
04_04_1263 - 32207636-32207938,32208020-32208170,32208263-322085...    28   6.0  
12_02_0854 + 23697826-23698033,23699111-23699276,23699430-236994...    28   7.9  
12_01_0655 + 5546293-5546478,5546760-5546877,5550697-5550776,555...    28   7.9  
04_04_0433 + 25163111-25163471,25163943-25164154,25164420-251647...    28   7.9  

>02_01_0037 +
           261405-261779,261880-262065,262185-262271,262341-262420,
           262518-262599,262794-262814,263204-263249,263365-263483,
           263685-263798,263885-263959,264068-264157,264604-264713,
           264902-265160
          Length = 547

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -3

Query: 671 GRFINAAGTTG-FPTGKRAVSATQLM*VSSLIRHPRLYTLCFRLVCCVE 528
           G  I A G  G +P GK+ VSA QL    S +RH +   L  +LV  V+
Sbjct: 146 GHMITAVGGHGGYPGGKQFVSADQLRDKLSYLRHEK--ALIIKLVDIVD 192


>06_03_0312 - 19471670-19471874,19472608-19472807
          Length = 134

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 18/52 (34%), Positives = 24/52 (46%)
 Frame = +1

Query: 250 RDGTILYDRRSTVSSELARTRGIRLSN*NKALRWPSRVLTQCDFCPVL*MST 405
           RDG I+YD      +    T   R    +  +R+PSRVL     CP L  +T
Sbjct: 35  RDGDIVYDENGLAGNTRGMTTSTRSPQLSWYVRYPSRVL-----CPSLPQAT 81


>04_04_1263 -
           32207636-32207938,32208020-32208170,32208263-32208500,
           32208604-32208814,32208927-32209108,32209196-32209297,
           32210002-32211187,32212103-32212499,32212551-32212582,
           32212885-32213157,32213307-32213394,32213486-32213723,
           32213824-32214034,32214119-32214300,32214378-32214479,
           32214801-32216224,32216751-32216822,32217688-32217719,
           32218186-32218263,32218425-32218512,32218608-32218845,
           32219060-32219162,32219386-32219558,32219644-32219745,
           32219825-32220606,32220659-32221012,32224055-32224140,
           32224250-32224400,32224534-32224771,32224876-32225119,
           32225190-32225368,32225577-32225675,32225835-32227083
          Length = 3195

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = -2

Query: 681 PARWPIH*CSWHDRFPDWKAG 619
           P +W +H   WH   P W++G
Sbjct: 900 PDQWGLHIVIWHGASPSWRSG 920


>12_02_0854 +
          23697826-23698033,23699111-23699276,23699430-23699466,
          23699531-23700145
          Length = 341

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 15/25 (60%), Positives = 16/25 (64%)
 Frame = -1

Query: 76 ARTSTRPGTGRIRFPSKPDTPRSSE 2
          A TST PG GR R PS P TP  S+
Sbjct: 16 AATSTDPGRGRKRPPS-PSTPTPSD 39


>12_01_0655 +
           5546293-5546478,5546760-5546877,5550697-5550776,
           5551329-5552345,5552523-5553344,5553528-5553800
          Length = 831

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 15/43 (34%), Positives = 19/43 (44%)
 Frame = +2

Query: 266 CTTAVQRSAQNWHGQGESDCLIKTKHCDGPRGC*RNVISAQCS 394
           C T   RS  N H   +  CL+  +H     G   NVI  +CS
Sbjct: 242 CDTERARSDTNEHNIYDGCCLLDVQHTQSFPGNGANVIPTKCS 284


>04_04_0433 +
           25163111-25163471,25163943-25164154,25164420-25164701,
           25164794-25164916,25165511-25165664,25165754-25165965,
           25166143-25166212,25166294-25166424
          Length = 514

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%)
 Frame = +2

Query: 266 CTTAVQRSAQNWHGQGESDCLIKTKHCDGPRGC-*RNVISAQCS 394
           CT++ +R A  W G G    L    HC  P       V+S +CS
Sbjct: 26  CTSSSRRRASPWGGAGRLIRLRLRGHCPSPASARAARVVSPRCS 69


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,194,972
Number of Sequences: 37544
Number of extensions: 390883
Number of successful extensions: 1081
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1048
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1081
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1733104716
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).