SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0101
         (509 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,890...    31   0.54 
06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764           31   0.71 
09_06_0251 - 21859484-21862162                                         29   1.6  
01_06_0456 + 29521282-29522064                                         29   1.6  
01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742...    29   2.9  
12_02_0912 - 24238659-24238897,24239353-24239462,24239548-242397...    28   3.8  
06_01_0437 + 3101449-3101521,3101872-3102232,3103766-3103958,310...    28   3.8  
05_01_0421 + 3308692-3309070,3309199-3309339,3309776-3309897,331...    28   3.8  
03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384...    28   3.8  
01_05_0535 - 23001864-23005052                                         28   3.8  
12_01_0843 + 7891622-7892524                                           28   5.0  
03_02_0747 + 10888358-10888481,10888529-10888609,10889011-108892...    28   5.0  
11_06_0229 + 21512943-21513237,21513273-21513756,21514668-21516657     27   6.6  
06_03_1448 + 30235336-30236763                                         27   6.6  
06_03_1443 + 30182018-30183445                                         27   6.6  
06_03_1440 + 30166515-30167942                                         27   6.6  
06_03_1437 + 30151030-30152457                                         27   6.6  
06_03_1429 + 30100834-30102261                                         27   6.6  
06_03_1425 + 30084383-30085810                                         27   6.6  
06_03_1420 - 30053713-30055140                                         27   6.6  
05_06_0221 + 26507795-26508937                                         27   6.6  
03_01_0545 - 4086692-4087591                                           27   8.8  
01_01_1195 - 9567023-9567789,9567871-9568120                           27   8.8  

>06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,
            8905437-8905690,8905785-8908799,8908889-8909001,
            8909975-8910164,8910399-8910512,8910591-8910698,
            8910941-8911073,8911206-8911408,8911626-8911826
          Length = 1889

 Score = 31.1 bits (67), Expect = 0.54
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +3

Query: 69   GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKQTLLSL 215
            G+  PR +  D  EW N  PT+   ++ + +PRE     Q+ K  +  L
Sbjct: 1393 GNCAPRTVECDEGEWYNNFPTIDENHVQRNKPREEQIFQQKLKPAIFIL 1441


>06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764
          Length = 640

 Score = 30.7 bits (66), Expect = 0.71
 Identities = 11/22 (50%), Positives = 14/22 (63%)
 Frame = -2

Query: 397 TTLHAWNDTPCARRYYRPCTAS 332
           TT  AW +TPCA R++  C  S
Sbjct: 560 TTTEAWVETPCAHRFHSRCLES 581


>09_06_0251 - 21859484-21862162
          Length = 892

 Score = 29.5 bits (63), Expect = 1.6
 Identities = 17/59 (28%), Positives = 29/59 (49%)
 Frame = -3

Query: 342 APLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYNARLESSSTGSAFPADSPKPVP 166
           APLPP         + +F   +   + H+  P+ +  +A   +  +G A P+ SP+PVP
Sbjct: 114 APLPP--------LLALFDPDTSSDLGHVFLPVSASASASNATDDSGVASPSPSPEPVP 164


>01_06_0456 + 29521282-29522064
          Length = 260

 Score = 29.5 bits (63), Expect = 1.6
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%)
 Frame = -1

Query: 464 AWQC--PRTGSRGSFKRRRAFPPRHHSARLER----HTVRPPILS 348
           AW+C  P +G+RG  +RRR  P    S R  R     T+RP + S
Sbjct: 12  AWRCYSPASGARGGSRRRRRRPAGTTSRRCSRADRLDTLRPYVTS 56


>01_06_1406 -
           37073548-37073822,37073892-37074111,37074200-37074246,
           37074404-37074576,37075161-37075238,37075751-37075813,
           37075889-37075961,37076150-37076189,37076302-37076368,
           37076719-37078472,37079128-37079230,37080041-37080078,
           37080221-37080347,37081944-37082152
          Length = 1088

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +3

Query: 405 RKRSSPFKTPA*SGSRTLPGGEFDWGGTSV 494
           +KR  P K PA S S+ LPG + + G  SV
Sbjct: 339 KKRGRPRKYPAPSNSKHLPGTDTELGNDSV 368


>12_02_0912 -
           24238659-24238897,24239353-24239462,24239548-24239741,
           24239839-24239907,24240096-24240282,24240683-24240969,
           24241593-24241880
          Length = 457

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 18/37 (48%), Positives = 22/37 (59%), Gaps = 4/37 (10%)
 Frame = -1

Query: 425 KRRRAFPPRHHSAR----LERHTVRPPILSTVHRFRP 327
           + RR +PP   SA     LER T  PPIL +V +FRP
Sbjct: 240 RTRRVYPPCDTSALQMLPLERSTT-PPILISVAQFRP 275


>06_01_0437 +
           3101449-3101521,3101872-3102232,3103766-3103958,
           3104051-3104848,3104997-3105143,3106024-3106377
          Length = 641

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = +1

Query: 361 GRTVCRSKR--AEW*RGGNARRRLKLPRDPVRGHCQAGSLTGA 483
           G+T+ R  R  A W RG  A RR +LP     G  +AG   G+
Sbjct: 36  GQTLTRGPRTCAVWRRGRAAVRRRRLPAASAEGGAKAGRSLGS 78


>05_01_0421 +
           3308692-3309070,3309199-3309339,3309776-3309897,
           3310369-3310632,3310719-3310849,3311254-3311461,
           3311564-3311632,3311722-3311799,3312448-3312621
          Length = 521

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 26/96 (27%), Positives = 41/96 (42%)
 Frame = -3

Query: 444 RITREF*TATSVSATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXI 265
           RI  E   AT+ ++T+   T G  HR     +   PLPP      T +V    R  R  +
Sbjct: 71  RIEEESPAATTTTSTT--ATTGVMHREGHGTLASRPLPPIHPPT-TPRVRKSSRIVRLEV 127

Query: 264 SHLSTPLMSPYNARLESSSTGSAFPADSPKPVPLAV 157
             L    ++ +  + +  ST +A P  S K + L +
Sbjct: 128 DRLQK--LTLWRDKKDDPSTAAALPTPSDKNMVLGM 161


>03_02_0740 -
           10836752-10837052,10837756-10837814,10837901-10838476,
           10839965-10841686,10841776-10842173,10842264-10842318,
           10842989-10843048,10843444-10843540,10844885-10844955,
           10845029-10845109,10846054-10846124,10847951-10848119,
           10848521-10848683,10848752-10848942,10849037-10849168
          Length = 1381

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = -2

Query: 484 PPQSNSPPGSVLEPDHAGVLNGDE 413
           P  +NS P +V +PD   +LNGDE
Sbjct: 739 PTSNNSVPQNVDQPDSKKMLNGDE 762


>01_05_0535 - 23001864-23005052
          Length = 1062

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 14/32 (43%), Positives = 16/32 (50%)
 Frame = -3

Query: 261 HLSTPLMSPYNARLESSSTGSAFPADSPKPVP 166
           H   P + P   R  SSS+ SA  A SP P P
Sbjct: 2   HRKLPPLPPLTLRRSSSSSSSAAAAASPPPPP 33


>12_01_0843 + 7891622-7892524
          Length = 300

 Score = 27.9 bits (59), Expect = 5.0
 Identities = 21/65 (32%), Positives = 28/65 (43%)
 Frame = -3

Query: 342 APLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYNARLESSSTGSAFPADSPKPVPL 163
           AP P   V+ +T+  VV   +  E        L SP      SSS+G      SP P P 
Sbjct: 66  APAPAPSVAGKTVPKVVGDCKEMEREKEKEKSLSSP-----SSSSSGMTSVESSPPPPPS 120

Query: 162 AVVSL 148
           A++ L
Sbjct: 121 AMLPL 125


>03_02_0747 +
           10888358-10888481,10888529-10888609,10889011-10889227,
           10889350-10889460,10889615-10889660,10889744-10889853,
           10889926-10890429,10891466-10891594,10891934-10892230,
           10892322-10892680,10892968-10893016,10893124-10893184,
           10893429-10893578,10893659-10893796,10894525-10894805,
           10895005-10895050
          Length = 900

 Score = 27.9 bits (59), Expect = 5.0
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = -3

Query: 357 DIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYNARLESSS 208
           DI+D  PLP    S    K++  +RR+   +S L+ P       R++  S
Sbjct: 86  DIVDAPPLPVLSFSPSKDKILFLKRRALPPLSDLAKPEEKLAGVRIDGYS 135


>11_06_0229 + 21512943-21513237,21513273-21513756,21514668-21516657
          Length = 922

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = -2

Query: 301 SSGFPATIARXDLPLIYTSHVSLQCQ 224
           S G P  +   +LPL+  +H+SL+C+
Sbjct: 855 SLGVPNDVGLGNLPLLNCAHISLECK 880


>06_03_1448 + 30235336-30236763
          Length = 475

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -2

Query: 469 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNDTPCARRYYRPCTAS 332
           +PP   L      +L+ GD+R+  V  LH W++     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1443 + 30182018-30183445
          Length = 475

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -2

Query: 469 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNDTPCARRYYRPCTAS 332
           +PP   L      +L+ GD+R+  V  LH W++     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1440 + 30166515-30167942
          Length = 475

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -2

Query: 469 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNDTPCARRYYRPCTAS 332
           +PP   L      +L+ GD+R+  V  LH W++     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1437 + 30151030-30152457
          Length = 475

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -2

Query: 469 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNDTPCARRYYRPCTAS 332
           +PP   L      +L+ GD+R+  V  LH W++     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1429 + 30100834-30102261
          Length = 475

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -2

Query: 469 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNDTPCARRYYRPCTAS 332
           +PP   L      +L+ GD+R+  V  LH W++     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1425 + 30084383-30085810
          Length = 475

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -2

Query: 469 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNDTPCARRYYRPCTAS 332
           +PP   L      +L+ GD+R+  V  LH W++     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1420 - 30053713-30055140
          Length = 475

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -2

Query: 469 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNDTPCARRYYRPCTAS 332
           +PP   L      +L+ GD+R+  V  LH W++     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>05_06_0221 + 26507795-26508937
          Length = 380

 Score = 27.5 bits (58), Expect = 6.6
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = +1

Query: 325 VGRKRCTVDNIGGRTVCRSKRAEW*R 402
           VGR  C +D +  R VC S RA + R
Sbjct: 21  VGRNLCEIDRLHARRVCHSWRAAFAR 46


>03_01_0545 - 4086692-4087591
          Length = 299

 Score = 27.1 bits (57), Expect = 8.8
 Identities = 18/67 (26%), Positives = 28/67 (41%)
 Frame = -3

Query: 408 SATSPLCTLGTTHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSREXISHLSTPLMSPYN 229
           +AT+PL     + R PA  + R  LPP       + +   +R         S+P  SP  
Sbjct: 184 AATAPLMMTSPSPRTPAAAVARWDLPPRGRGVFVLSISPLRREISVSTEAPSSPEPSPQR 243

Query: 228 ARLESSS 208
            R  ++S
Sbjct: 244 HRHRAAS 250


>01_01_1195 - 9567023-9567789,9567871-9568120
          Length = 338

 Score = 27.1 bits (57), Expect = 8.8
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = -3

Query: 234 YNARLESSSTGSAFPADSPKPVPLAVVSL 148
           +  R  SSS+ S  PA +P P P  VV+L
Sbjct: 157 FRRRKPSSSSASPAPAPAPPPPPQPVVAL 185


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,186,257
Number of Sequences: 37544
Number of extensions: 338796
Number of successful extensions: 1201
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 1162
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1199
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1095026320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).