SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0100
         (644 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_08_0956 + 21796707-21797497,21799603-21799861,21799969-21800142     30   1.4  
03_04_0006 + 16257288-16259522                                         30   1.8  
05_02_0028 - 5764980-5766374                                           29   2.4  
06_03_0854 + 25400855-25403741,25406174-25407708                       29   3.2  
01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742...    29   4.2  
07_03_1140 - 24258627-24258849,24259967-24260089,24260200-242609...    28   5.5  
03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384...    28   5.5  
01_06_0456 + 29521282-29522064                                         28   5.5  
12_02_0077 - 13288916-13289659,13289689-13289691                       28   7.3  
07_01_0861 + 7152976-7153061,7153222-7153310,7154862-7155013,715...    28   7.3  
04_01_0416 - 5504415-5504590,5509032-5509116,5509190-5509322,550...    28   7.3  
03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399     28   7.3  
02_05_0597 + 30245455-30245767,30246693-30246760,30246851-302469...    28   7.3  
10_08_0480 - 18203186-18203284,18203821-18204006,18204590-182047...    27   9.7  
02_04_0220 - 21014225-21014386,21014492-21014572,21014739-210149...    27   9.7  
01_07_0197 + 41912207-41912652,41913226-41913800,41913828-419157...    27   9.7  
01_06_1759 + 39689410-39689573,39689728-39689923,39690014-396901...    27   9.7  

>10_08_0956 + 21796707-21797497,21799603-21799861,21799969-21800142
          Length = 407

 Score = 30.3 bits (65), Expect = 1.4
 Identities = 22/84 (26%), Positives = 35/84 (41%)
 Frame = -2

Query: 415 ELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDERFRHVTTLHAWNETPWPADIID 236
           E   GH +  + D     N  PGS +  +H+ VLN  +  R      A+ + P   D ++
Sbjct: 313 ETQAGHWQNGVLDTLSTQNIIPGSPIAVNHSKVLNAVQEARRAAE-RAY-DVPRVDDKVN 370

Query: 235 RAPLPPNRVSNETMKVVVFQRRSR 164
           RA    N+ +N      V   + R
Sbjct: 371 RAVASANKAANAARVAAVKAAQKR 394


>03_04_0006 + 16257288-16259522
          Length = 744

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 3/54 (5%)
 Frame = -3

Query: 165 AKRSP---TYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQWE 13
           A+RSP    Y T L +   ARL    T    PA SP    +AV S   + G W+
Sbjct: 162 ARRSPWTVVYGTNLRTGETARLTPRGTFDLSPAVSPSGKRVAVASWQGKPGLWD 215


>05_02_0028 - 5764980-5766374
          Length = 464

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 3/35 (8%)
 Frame = -1

Query: 332 GSRGSFKRRRAFPPRHHSA---RLERNTVARRYYR 237
           G  G + R  + PP HHS    RL  NT+ RR +R
Sbjct: 20  GLSGLYSRASSSPPLHHSGSRRRLRTNTLPRRSWR 54


>06_03_0854 + 25400855-25403741,25406174-25407708
          Length = 1473

 Score = 29.1 bits (62), Expect = 3.2
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = -3

Query: 165 AKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 40
           AKR+PT  T    P  AR  +++   +F   +P P P +V+S
Sbjct: 475 AKRAPTAVTVGAPPPQARTPAAAPAKAF-VSAPAPAPSSVIS 515


>01_06_1406 -
           37073548-37073822,37073892-37074111,37074200-37074246,
           37074404-37074576,37075161-37075238,37075751-37075813,
           37075889-37075961,37076150-37076189,37076302-37076368,
           37076719-37078472,37079128-37079230,37080041-37080078,
           37080221-37080347,37081944-37082152
          Length = 1088

 Score = 28.7 bits (61), Expect = 4.2
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +3

Query: 294 RKRSSPFKTPA*SGSRTLPGGEFDWGGTSV 383
           +KR  P K PA S S+ LPG + + G  SV
Sbjct: 339 KKRGRPRKYPAPSNSKHLPGTDTELGNDSV 368


>07_03_1140 -
           24258627-24258849,24259967-24260089,24260200-24260921,
           24260945-24261073,24261484-24261714
          Length = 475

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 11/17 (64%), Positives = 13/17 (76%)
 Frame = -2

Query: 580 CHKPVIPVVTFLAPLVK 530
           C KP+IP  T +APLVK
Sbjct: 307 CRKPIIPSGTMVAPLVK 323


>03_02_0740 -
           10836752-10837052,10837756-10837814,10837901-10838476,
           10839965-10841686,10841776-10842173,10842264-10842318,
           10842989-10843048,10843444-10843540,10844885-10844955,
           10845029-10845109,10846054-10846124,10847951-10848119,
           10848521-10848683,10848752-10848942,10849037-10849168
          Length = 1381

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = -2

Query: 373 PPQSNSPPGSVLEPDHAGVLNGDE 302
           P  +NS P +V +PD   +LNGDE
Sbjct: 739 PTSNNSVPQNVDQPDSKKMLNGDE 762


>01_06_0456 + 29521282-29522064
          Length = 260

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%)
 Frame = -1

Query: 353 AWQC--PRTGSRGSFKRRRAFPPRHHSARLER 264
           AW+C  P +G+RG  +RRR  P    S R  R
Sbjct: 12  AWRCYSPASGARGGSRRRRRRPAGTTSRRCSR 43


>12_02_0077 - 13288916-13289659,13289689-13289691
          Length = 248

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -3

Query: 108 ESSSTGSSFPADSPKPVPLAVVSLDSR 28
           ++ S G S P DS + VP+ VV+L  R
Sbjct: 3   DNQSLGKSLPKDSRRHVPVGVVALKKR 29


>07_01_0861 +
           7152976-7153061,7153222-7153310,7154862-7155013,
           7155254-7155382,7155465-7155581,7156353-7156496,
           7156749-7156851,7157471-7157565,7157953-7158096
          Length = 352

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 1/56 (1%)
 Frame = -2

Query: 349 GSVLEPDHAGVLNGDERFRHVTT-LHAWNETPWPADIIDRAPLPPNRVSNETMKVV 185
           GS+ + D    L G   + H+   LH   E   PA+IID        + +E +K V
Sbjct: 184 GSIKDADKEEKLKGKPGYEHLNDPLHILIEAELPANIIDTRLRQAQEIMDELLKPV 239


>04_01_0416 -
           5504415-5504590,5509032-5509116,5509190-5509322,
           5509426-5510312
          Length = 426

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = -3

Query: 138 PLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDS 31
           PL+ P  AR   SSTGSSFP  S  P    ++ L S
Sbjct: 47  PLIHPTPARF-ISSTGSSFPPYSEPPPSAPMLELGS 81


>03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399
          Length = 146

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 21/69 (30%), Positives = 30/69 (43%)
 Frame = +1

Query: 247 RRATVFRSKRAEW*RGGNARRRLKLPRDPVRGHCQAGSLTGAVHLSKNNAGVLRPAQRGQ 426
           R   +   +R E    G +RR   L  D +RG+ +      A H     AG    + RG 
Sbjct: 57  RLRCIAEGRREEEEEVGRSRRGKDLDLDDMRGYGET-----ATHHGLRLAGREEVSPRGG 111

Query: 427 KPRVEQKGK 453
           KPRV+  G+
Sbjct: 112 KPRVDNGGR 120


>02_05_0597 +
           30245455-30245767,30246693-30246760,30246851-30246939,
           30247047-30247212,30247296-30247585,30247692-30247896,
           30248013-30248170,30248352-30248595
          Length = 510

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 8/17 (47%), Positives = 13/17 (76%)
 Frame = -2

Query: 259 PWPADIIDRAPLPPNRV 209
           P P  ++++APLPP R+
Sbjct: 90  PMPVPVVEKAPLPPKRI 106


>10_08_0480 -
           18203186-18203284,18203821-18204006,18204590-18204736,
           18204829-18204912,18206290-18206532
          Length = 252

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 5/61 (8%)
 Frame = -1

Query: 404 RTPALFFDRCTAPVKLPAWQCPRTGSRGS-FKRRRAF----PPRHHSARLERNTVARRYY 240
           ++P+  +DR  A  +LP+ + P + S G+ +  RR++    P   +S+R       R  Y
Sbjct: 172 KSPSASYDRYAATTRLPSRELPSSISPGADYMSRRSYLDQVPTDRYSSRAAEQIHGREDY 231

Query: 239 R 237
           R
Sbjct: 232 R 232


>02_04_0220 -
           21014225-21014386,21014492-21014572,21014739-21014938,
           21014999-21015157,21015248-21015377,21015520-21015673,
           21015785-21015867,21015981-21016040,21016131-21016217
          Length = 371

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +1

Query: 337 RGHCQAGSLTGAVHLSKNNAGVLRPAQRGQKPRVEQKGKSWL 462
           +GH     +T A    KNNAG L+  Q  Q+    Q GK  L
Sbjct: 212 KGHLWRSQITAAKEDKKNNAGALQLLQL-QEEACRQSGKDGL 252


>01_07_0197 +
           41912207-41912652,41913226-41913800,41913828-41915748,
           41915836-41916049,41916143-41916394,41916469-41916528,
           41916646-41916776,41916898-41917012,41917084-41917239
          Length = 1289

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = +3

Query: 519 YKEFLTRG-ARKVTTGITGLWQPSVHSDVAF*SFDVG 626
           YK F   G  RKV  GIT  + PS+  D+AF S  +G
Sbjct: 633 YKIFQAFGLVRKVEKGITRWYYPSMLDDLAFDSAALG 669


>01_06_1759 +
           39689410-39689573,39689728-39689923,39690014-39690103,
           39690221-39690277,39690391-39690460,39690747-39690811,
           39691408-39691462,39691704-39691831,39691919-39691950,
           39692205-39692274,39692723-39692824,39692921-39693010,
           39693084-39693232,39693620-39693731,39695332-39695412,
           39695481-39695705,39695815-39695937,39696021-39696137
          Length = 641

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 9/26 (34%), Positives = 15/26 (57%)
 Frame = -2

Query: 409 ALGHLRYSLTDVPPQSNSPPGSVLEP 332
           ALGH+   L + P ++  PP   ++P
Sbjct: 494 ALGHIELDLPEAPEKAPKPPAQAVDP 519


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,894,580
Number of Sequences: 37544
Number of extensions: 431183
Number of successful extensions: 1470
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1419
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1468
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1596695220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).