SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0099
         (684 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_0456 + 29521282-29522064                                         32   0.49 
06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,890...    31   0.85 
09_02_0221 + 5962606-5963197,5963711-5963837,5963994-5964100,596...    30   1.5  
10_07_0045 + 12328388-12328419,12328504-12328645,12328862-123290...    29   3.4  
03_01_0545 - 4086692-4087591                                           29   3.4  
06_03_1448 + 30235336-30236763                                         29   4.5  
06_03_1443 + 30182018-30183445                                         29   4.5  
06_03_1440 + 30166515-30167942                                         29   4.5  
06_03_1437 + 30151030-30152457                                         29   4.5  
06_03_1429 + 30100834-30102261                                         29   4.5  
06_03_1425 + 30084383-30085810                                         29   4.5  
06_03_1420 - 30053713-30055140                                         29   4.5  
06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764           29   4.5  
03_04_0006 + 16257288-16259522                                         29   4.5  
01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742...    29   4.5  
12_01_0856 + 8034181-8035425                                           28   6.0  
03_05_0934 - 28935728-28935859,28936000-28936122,28936172-289362...    28   6.0  
03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384...    28   6.0  
12_02_0077 - 13288916-13289659,13289689-13289691                       28   7.9  
12_01_0843 + 7891622-7892524                                           28   7.9  
06_01_0715 - 5193648-5193897,5193987-5194255,5195011-5195350,519...    28   7.9  
06_01_0437 + 3101449-3101521,3101872-3102232,3103766-3103958,310...    28   7.9  
04_01_0416 - 5504415-5504590,5509032-5509116,5509190-5509322,550...    28   7.9  

>01_06_0456 + 29521282-29522064
          Length = 260

 Score = 31.9 bits (69), Expect = 0.49
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 6/47 (12%)
 Frame = -2

Query: 452 AWQC--PRTGSRGSFKRRRAFPPRHHSARLER----NTVRPPILSTA 330
           AW+C  P +G+RG  +RRR  P    S R  R    +T+RP + S A
Sbjct: 12  AWRCYSPASGARGGSRRRRRRPAGTTSRRCSRADRLDTLRPYVTSAA 58


>06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,
            8905437-8905690,8905785-8908799,8908889-8909001,
            8909975-8910164,8910399-8910512,8910591-8910698,
            8910941-8911073,8911206-8911408,8911626-8911826
          Length = 1889

 Score = 31.1 bits (67), Expect = 0.85
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +3

Query: 57   GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLSL 203
            G+  PR +  D  EW N  PT+   ++ + +PRE     Q+ K  +  L
Sbjct: 1393 GNCAPRTVECDEGEWYNNFPTIDENHVQRNKPREEQIFQQKLKPAIFIL 1441


>09_02_0221 +
           5962606-5963197,5963711-5963837,5963994-5964100,
           5964185-5964328,5964700-5964822,5964921-5965103,
           5965540-5965718,5965797-5965823
          Length = 493

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 20/57 (35%), Positives = 25/57 (43%)
 Frame = -1

Query: 276 QRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQWESR 106
           QR S E    Y TP  + Y A   SSS GSS     P   P+A++    +    E R
Sbjct: 290 QRSSFEQKTNYQTPASALYGAYEGSSSQGSSSGYGEPPKDPVALMEFYMKKAAQEER 346


>10_07_0045 +
           12328388-12328419,12328504-12328645,12328862-12329054,
           12329224-12329320,12329404-12329528,12329616-12329734,
           12331225-12331298,12331359-12331413,12331450-12331500,
           12331611-12331857,12331940-12332036,12332170-12332244,
           12334286-12334488,12334757-12334905,12334995-12335168,
           12335276-12335401,12335493-12335623,12335743-12335818,
           12335898-12336027,12336115-12336193,12336267-12336465,
           12336591-12336698,12336769-12337025,12337267-12337282
          Length = 984

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 11/40 (27%), Positives = 19/40 (47%)
 Frame = +1

Query: 223 RRHERCSISGSRFARSSLKNHYFHCFITYSVGRKRCAVDN 342
           +RH  C +SG +F    + + Y HC    +   K+   +N
Sbjct: 537 KRHLTCLLSGDKFLNDDVISAYIHCLSEQANNDKKVKYEN 576


>03_01_0545 - 4086692-4087591
          Length = 299

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 18/67 (26%), Positives = 29/67 (43%)
 Frame = -1

Query: 396 SATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYN 217
           +AT+PL       R PA  + R  LPP       + +   +R    +T   ++P  SP  
Sbjct: 184 AATAPLMMTSPSPRTPAAAVARWDLPPRGRGVFVLSISPLRREISVSTEAPSSPEPSPQR 243

Query: 216 ARLESSS 196
            R  ++S
Sbjct: 244 HRHRAAS 250


>06_03_1448 + 30235336-30236763
          Length = 475

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 457 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 320
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1443 + 30182018-30183445
          Length = 475

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 457 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 320
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1440 + 30166515-30167942
          Length = 475

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 457 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 320
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1437 + 30151030-30152457
          Length = 475

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 457 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 320
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1429 + 30100834-30102261
          Length = 475

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 457 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 320
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1425 + 30084383-30085810
          Length = 475

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 457 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 320
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1420 - 30053713-30055140
          Length = 475

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -3

Query: 457 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 320
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764
          Length = 640

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = -3

Query: 385 TTLHAWNETPCARRYY 338
           TT  AW ETPCA R++
Sbjct: 560 TTTEAWVETPCAHRFH 575


>03_04_0006 + 16257288-16259522
          Length = 744

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 21/57 (36%), Positives = 25/57 (43%)
 Frame = -1

Query: 282 VFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQWE 112
           V  RRS  T   Y T L +   ARL    T    PA SP    +AV S   + G W+
Sbjct: 160 VAARRSPWTV-VYGTNLRTGETARLTPRGTFDLSPAVSPSGKRVAVASWQGKPGLWD 215


>01_06_1406 -
           37073548-37073822,37073892-37074111,37074200-37074246,
           37074404-37074576,37075161-37075238,37075751-37075813,
           37075889-37075961,37076150-37076189,37076302-37076368,
           37076719-37078472,37079128-37079230,37080041-37080078,
           37080221-37080347,37081944-37082152
          Length = 1088

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +3

Query: 393 RKRSSPFKTPA*SGSRTLPGGEFDWGGTSV 482
           +KR  P K PA S S+ LPG + + G  SV
Sbjct: 339 KKRGRPRKYPAPSNSKHLPGTDTELGNDSV 368


>12_01_0856 + 8034181-8035425
          Length = 414

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 17/46 (36%), Positives = 22/46 (47%)
 Frame = +2

Query: 482 QRITQVS*GSSARTETSRGAKGQKLA*SRCSVRIGTAKARPIDPLV 619
           QRIT  +  S+ R   +    GQ     RC V    AK +PID L+
Sbjct: 193 QRITDRTPSSARRQNRNDNVIGQSEDKLRCRVESVVAKKKPIDRLI 238


>03_05_0934 -
           28935728-28935859,28936000-28936122,28936172-28936284,
           28936363-28936430,28936517-28936600,28936937-28936980,
           28937061-28937204,28937518-28937582,28937722-28937814,
           28938132-28938262,28938375-28938394,28938904-28938987,
           28939157-28939330,28940106-28940195,28940293-28940364,
           28941318-28941365,28941458-28941570,28942786-28942849,
           28942943-28943016,28943162-28943201
          Length = 591

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 14/43 (32%), Positives = 20/43 (46%)
 Frame = -2

Query: 518 SLSCLRTPALFVDRCTAPVKLPAWQCPRTGSRGSFKRRRAFPP 390
           S++ +R+    + R  AP K PAW     G+R   K     PP
Sbjct: 306 SITIMRSDENILQRLDAPTKAPAWPVGSEGNRPPAKIPVPVPP 348


>03_02_0740 -
           10836752-10837052,10837756-10837814,10837901-10838476,
           10839965-10841686,10841776-10842173,10842264-10842318,
           10842989-10843048,10843444-10843540,10844885-10844955,
           10845029-10845109,10846054-10846124,10847951-10848119,
           10848521-10848683,10848752-10848942,10849037-10849168
          Length = 1381

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = -3

Query: 472 PPQSNSPPGSVLEPDHAGVLNGDE 401
           P  +NS P +V +PD   +LNGDE
Sbjct: 739 PTSNNSVPQNVDQPDSKKMLNGDE 762


>12_02_0077 - 13288916-13289659,13289689-13289691
          Length = 248

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -1

Query: 207 ESSSTGSSFPADSPKPVPLAVVSLDSR 127
           ++ S G S P DS + VP+ VV+L  R
Sbjct: 3   DNQSLGKSLPKDSRRHVPVGVVALKKR 29


>12_01_0843 + 7891622-7892524
          Length = 300

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 21/65 (32%), Positives = 29/65 (44%)
 Frame = -1

Query: 330 APLPPNRVSNETMKVVVFQRRSRETTPTYATPLMSPYNARLESSSTGSSFPADSPKPVPL 151
           AP P   V+ +T+  VV   +  E        L SP      SSS+G +    SP P P 
Sbjct: 66  APAPAPSVAGKTVPKVVGDCKEMEREKEKEKSLSSP-----SSSSSGMTSVESSPPPPPS 120

Query: 150 AVVSL 136
           A++ L
Sbjct: 121 AMLPL 125


>06_01_0715 -
           5193648-5193897,5193987-5194255,5195011-5195350,
           5195691-5195845,5196547-5196557,5197632-5197689,
           5197855-5198004,5198074-5198169,5198398-5198818,
           5198835-5198950,5199041-5199149,5199483-5199532,
           5200936-5201004,5201366-5201459,5201550-5201820,
           5202273-5202607,5202718-5202786,5202834-5202904
          Length = 977

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 20/55 (36%), Positives = 26/55 (47%)
 Frame = -2

Query: 566 WIKPAFALLLHARFLSSLSCLRTPALFVDRCTAPVKLPAWQCPRTGSRGSFKRRR 402
           W+K  F  +L    L S++CL TP + V R  A  K  A       S  S +RRR
Sbjct: 36  WLKWRFECVLSR--LCSVACLATPRIAVARSLAGAKDDANILRPADSHNSERRRR 88


>06_01_0437 +
           3101449-3101521,3101872-3102232,3103766-3103958,
           3104051-3104848,3104997-3105143,3106024-3106377
          Length = 641

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = +1

Query: 349 GRTVFRSKR--AEW*RGGNARRRLKLPRDPVRGHCQAGSLTGA 471
           G+T+ R  R  A W RG  A RR +LP     G  +AG   G+
Sbjct: 36  GQTLTRGPRTCAVWRRGRAAVRRRRLPAASAEGGAKAGRSLGS 78


>04_01_0416 -
           5504415-5504590,5509032-5509116,5509190-5509322,
           5509426-5510312
          Length = 426

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = -1

Query: 237 PLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDS 130
           PL+ P  AR   SSTGSSFP  S  P    ++ L S
Sbjct: 47  PLIHPTPARF-ISSTGSSFPPYSEPPPSAPMLELGS 81


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,151,444
Number of Sequences: 37544
Number of extensions: 464241
Number of successful extensions: 1483
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 1422
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1482
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1733104716
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).