SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0097
         (620 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0319 - 2499470-2499598,2499681-2499746,2499830-2499937,250...    30   1.3  
12_01_0250 - 1852619-1854124,1855224-1856153,1856293-1856409,185...    28   5.2  
05_01_0033 + 220125-220190,220274-224445,224863-224949,225048-22...    28   6.9  
04_03_0150 + 11877714-11878487,11880928-11881245                       28   6.9  
02_04_0357 - 22339691-22339773,22340087-22340371,22340407-22340524     28   6.9  
01_06_1608 - 38612754-38616947,38617030-38617095                       28   6.9  
03_02_0098 + 5608787-5610812,5610956-5611053                           27   9.1  

>03_01_0319 -
           2499470-2499598,2499681-2499746,2499830-2499937,
           2500125-2500259,2500763-2500840,2500994-2501044,
           2501805-2501879,2501975-2502037,2503048-2503137,
           2503215-2503406,2503498-2503591,2503776-2504279,
           2504415-2504614,2504712-2504756,2505023-2505082,
           2505476-2505520,2505858-2505941,2506121-2506318,
           2506960-2507667
          Length = 974

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 3/61 (4%)
 Frame = -2

Query: 337 WDMT*VCKRHIVESIKRNFSAILQPKEAVLSLVVENCGVKSKETFAFFPFLR---WHSRL 167
           W    +C+   +ES+   F+A L  K+ V  ++  N GV S    +  P +R   W S L
Sbjct: 727 WTTATICRALSLESVLELFAAALLEKQIV--VICSNLGVLSAIVLSVMPMIRPFQWQSLL 784

Query: 166 L 164
           L
Sbjct: 785 L 785


>12_01_0250 -
           1852619-1854124,1855224-1856153,1856293-1856409,
           1856777-1857157
          Length = 977

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 4/87 (4%)
 Frame = -2

Query: 298 SIKRNFSAILQPKEAVLSLVVENCGVKSKETFAFFPFLRWHSRLLTQGSIRTSFTVHALA 119
           +++ +FSAI + KE +LS  ++NC  ++KE       L W S  L   S+R   T   + 
Sbjct: 431 NVQLSFSAIREGKENLLSFGLKNC--QNKEDRGCL-LLSWGSTNLYSISLRLCCTDRGMF 487

Query: 118 S----TSRHSLVVTTLNSARPQPRNAA 50
                +S  S   +++ S  P P N +
Sbjct: 488 QDDMLSSATSSPASSVYSPSPSPSNGS 514


>05_01_0033 + 220125-220190,220274-224445,224863-224949,225048-225084,
            225296-225356,225666-226918
          Length = 1891

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = +3

Query: 147  RIDPCVNSRLCHLKKGKNAKVSFDFTPQFSTTKLKTASLG*RMAL 281
            R+  CV      LK   +   S  FTP+F+  KL TAS   ++A+
Sbjct: 1106 RLKSCVRLEKEGLKHRTSPSWSLSFTPKFTDEKLLTASSKPKVAI 1150


>04_03_0150 + 11877714-11878487,11880928-11881245
          Length = 363

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 17/52 (32%), Positives = 24/52 (46%)
 Frame = +1

Query: 79  NSTSSPQGYAGKWTPARVL*TRSELTPVLTVDCATSRKGKTRRFLSTLHHNS 234
           N + SP+G      PAR    RS  TP    + A +     R   S+++HNS
Sbjct: 16  NKSQSPRGACASTEPARTQAKRSRPTPAGGNEQAVAVVVPRRSLPSSINHNS 67


>02_04_0357 - 22339691-22339773,22340087-22340371,22340407-22340524
          Length = 161

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +1

Query: 454 CCYRTNVRLV**TQKTTAPDCIVNTLC 534
           C YR+ +R     Q+T  PDC+V+  C
Sbjct: 87  CIYRSKLRSQYGLQETPCPDCLVHLWC 113


>01_06_1608 - 38612754-38616947,38617030-38617095
          Length = 1419

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 16/45 (35%), Positives = 23/45 (51%)
 Frame = +3

Query: 147  RIDPCVNSRLCHLKKGKNAKVSFDFTPQFSTTKLKTASLG*RMAL 281
            R+  CV      LK   +   S  FTP+F+  KL TAS   ++A+
Sbjct: 1110 RLKSCVRLEKEGLKHRTSPSWSLSFTPKFTDEKLLTASSKPKVAI 1154


>03_02_0098 + 5608787-5610812,5610956-5611053
          Length = 707

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = -3

Query: 501 CFLCLLNKPDIRSVAAHLALIVFIPKLPF 415
           CFLC + +PD R   A LA   F  +LP+
Sbjct: 48  CFLCAIKEPDARLRRASLA--AFFRELPY 74


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,382,559
Number of Sequences: 37544
Number of extensions: 340572
Number of successful extensions: 837
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 822
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 837
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1502076244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).