SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0092
         (720 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,890...    34   0.13 
05_04_0306 + 20058640-20059159,20060406-20060819,20060921-200611...    30   2.1  
02_05_0110 + 25914110-25915006,25915726-25915797,25916411-259166...    30   2.1  
01_06_1060 + 34162161-34162554,34162613-34162675,34163262-341635...    29   2.8  
01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349     29   2.8  
06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764           29   4.9  
03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998     28   6.5  

>06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,
            8905437-8905690,8905785-8908799,8908889-8909001,
            8909975-8910164,8910399-8910512,8910591-8910698,
            8910941-8911073,8911206-8911408,8911626-8911826
          Length = 1889

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 19/66 (28%), Positives = 31/66 (46%)
 Frame = +3

Query: 369  GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLA*L*SGIVRRHER 548
            G+  PR +  D  EW N  PT+   ++ + +PRE     Q+ K  +       I+   E 
Sbjct: 1393 GNCAPRTVECDEGEWYNNFPTIDENHVQRNKPREEQIFQQKLKPAIF------ILNSDES 1446

Query: 549  CSISGR 566
            CS+ G+
Sbjct: 1447 CSLKGK 1452


>05_04_0306 +
           20058640-20059159,20060406-20060819,20060921-20061190,
           20062179-20062849
          Length = 624

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 21/93 (22%), Positives = 39/93 (41%), Gaps = 2/93 (2%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           ++ SSY  +WI   V     D+P R +   S    ++       +R ++ +         
Sbjct: 515 NKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAF 574

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
           +   HW    G+D M F  +  N+N  V +++Q
Sbjct: 575 L---HWYTGEGMDEMEFTEAESNMNDLVSEYQQ 604


>02_05_0110 +
           25914110-25915006,25915726-25915797,25916411-25916699,
           25916864-25916949,25917267-25917490,25917674-25917740,
           25917830-25917889,25917995-25918078,25918475-25918555
          Length = 619

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = -1

Query: 393 LDDEAFGYL-KRVIVTPAVYPRLLEFLHVDIQSTG 292
           LDDE   YL  R  V   +  RLL+F++VD  STG
Sbjct: 279 LDDEDISYLTNRAAVYIEMGKRLLKFIYVDPSSTG 313


>01_06_1060 +
           34162161-34162554,34162613-34162675,34163262-34163531,
           34163944-34164623
          Length = 468

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 21/93 (22%), Positives = 39/93 (41%), Gaps = 2/93 (2%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           ++ SSY  +WI   V     D+P R +   S    ++       +R ++ +         
Sbjct: 356 NKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAF 415

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
           +   HW    G+D M F  +  N+N  V +++Q
Sbjct: 416 L---HWYTGEGMDEMEFTEAESNMNDLVSEYQQ 445


>01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349
          Length = 447

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 21/93 (22%), Positives = 39/93 (41%), Gaps = 2/93 (2%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           ++ SSY  +WI   V     D+P R +   S    ++       +R ++ +         
Sbjct: 335 NKNSSYFVEWIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAF 394

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN--VKKFKQ 330
           +   HW    G+D M F  +  N+N  V +++Q
Sbjct: 395 L---HWYTGEGMDEMEFTEAESNMNDLVSEYQQ 424


>06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764
          Length = 640

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = -3

Query: 697 TTLHAWNETPCARRYY 650
           TT  AW ETPCA R++
Sbjct: 560 TTTEAWVETPCAHRFH 575


>03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998
          Length = 444

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 18/85 (21%), Positives = 34/85 (40%)
 Frame = +1

Query: 58  SRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCL 237
           ++ SSY  +WI   V     D+P R +   +    ++       +R ++ +         
Sbjct: 335 NKNSSYFVEWIPNNVKSSVCDIPPRGLKMAATFVGNSTSIQEMFRRVSEQFTAMFRRKAF 394

Query: 238 IKTKHWMALAGVDAM*FLPSALNVN 312
           +   HW    G+D M F  +  N+N
Sbjct: 395 L---HWYTGEGMDEMEFTEAESNMN 416


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,117,869
Number of Sequences: 37544
Number of extensions: 464319
Number of successful extensions: 1258
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1223
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1250
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1874582652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).