SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0091
         (727 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_06_0456 + 29521282-29522064                                         32   0.53 
06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,890...    31   0.93 
02_04_0220 - 21014225-21014386,21014492-21014572,21014739-210149...    31   1.2  
03_04_0006 + 16257288-16259522                                         30   2.2  
06_03_0854 + 25400855-25403741,25406174-25407708                       29   3.8  
03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399     29   3.8  
06_03_1448 + 30235336-30236763                                         29   5.0  
06_03_1443 + 30182018-30183445                                         29   5.0  
06_03_1440 + 30166515-30167942                                         29   5.0  
06_03_1437 + 30151030-30152457                                         29   5.0  
06_03_1429 + 30100834-30102261                                         29   5.0  
06_03_1425 + 30084383-30085810                                         29   5.0  
06_03_1420 - 30053713-30055140                                         29   5.0  
06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764           29   5.0  
01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742...    29   5.0  
03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384...    28   6.6  
02_02_0406 - 9888167-9888570,9890168-9890248,9892207-9892600           28   6.6  
01_07_0197 + 41912207-41912652,41913226-41913800,41913828-419157...    28   6.6  
12_02_0077 - 13288916-13289659,13289689-13289691                       28   8.7  
09_02_0221 + 5962606-5963197,5963711-5963837,5963994-5964100,596...    28   8.7  
08_02_1371 + 26493981-26494471,26497374-26497504,26497947-26498692     28   8.7  
06_01_0437 + 3101449-3101521,3101872-3102232,3103766-3103958,310...    28   8.7  
04_01_0416 - 5504415-5504590,5509032-5509116,5509190-5509322,550...    28   8.7  
03_02_0474 - 8759585-8759626,8759753-8759893,8760001-8760093,876...    28   8.7  

>01_06_0456 + 29521282-29522064
          Length = 260

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 6/47 (12%)
 Frame = -3

Query: 407 AWQC--PRTGSRGSFKRRRAFPPRHHSARLER----NTVRPPILSTA 285
           AW+C  P +G+RG  +RRR  P    S R  R    +T+RP + S A
Sbjct: 12  AWRCYSPASGARGGSRRRRRRPAGTTSRRCSRADRLDTLRPYVTSAA 58


>06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,
            8905437-8905690,8905785-8908799,8908889-8909001,
            8909975-8910164,8910399-8910512,8910591-8910698,
            8910941-8911073,8911206-8911408,8911626-8911826
          Length = 1889

 Score = 31.1 bits (67), Expect = 0.93
 Identities = 15/49 (30%), Positives = 24/49 (48%)
 Frame = +3

Query: 12   GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLSL 158
            G+  PR +  D  EW N  PT+   ++ + +PRE     Q+ K  +  L
Sbjct: 1393 GNCAPRTVECDEGEWYNNFPTIDENHVQRNKPREEQIFQQKLKPAIFIL 1441


>02_04_0220 -
           21014225-21014386,21014492-21014572,21014739-21014938,
           21014999-21015157,21015248-21015377,21015520-21015673,
           21015785-21015867,21015981-21016040,21016131-21016217
          Length = 371

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 20/53 (37%), Positives = 26/53 (49%)
 Frame = +1

Query: 391 RGHCQAGSLTGAVHLSKNNAGVLRPAQRGQKPRVEQKGKTGLIQMFSTHRDCE 549
           +GH     +T A    KNNAG L+  Q  Q+    Q GK GL    +T RD +
Sbjct: 212 KGHLWRSQITAAKEDKKNNAGALQLLQL-QEEACRQSGKDGL----ATERDVD 259


>03_04_0006 + 16257288-16259522
          Length = 744

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 3/54 (5%)
 Frame = -2

Query: 219 AKRSP---TYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQWE 67
           A+RSP    Y T L +   ARL    T    PA SP    +AV S   + G W+
Sbjct: 162 ARRSPWTVVYGTNLRTGETARLTPRGTFDLSPAVSPSGKRVAVASWQGKPGLWD 215


>06_03_0854 + 25400855-25403741,25406174-25407708
          Length = 1473

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = -2

Query: 219 AKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 94
           AKR+PT  T    P  AR  +++   +F   +P P P +V+S
Sbjct: 475 AKRAPTAVTVGAPPPQARTPAAAPAKAF-VSAPAPAPSSVIS 515


>03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399
          Length = 146

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 21/67 (31%), Positives = 30/67 (44%)
 Frame = +1

Query: 307 RTVFRSKRAEW*RGGNARRRLKLPRDPVRGHCQAGSLTGAVHLSKNNAGVLRPAQRGQKP 486
           R +   +R E    G +RR   L  D +RG+ +      A H     AG    + RG KP
Sbjct: 59  RCIAEGRREEEEEVGRSRRGKDLDLDDMRGYGET-----ATHHGLRLAGREEVSPRGGKP 113

Query: 487 RVEQKGK 507
           RV+  G+
Sbjct: 114 RVDNGGR 120


>06_03_1448 + 30235336-30236763
          Length = 475

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -1

Query: 412 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 275
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1443 + 30182018-30183445
          Length = 475

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -1

Query: 412 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 275
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1440 + 30166515-30167942
          Length = 475

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -1

Query: 412 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 275
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1437 + 30151030-30152457
          Length = 475

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -1

Query: 412 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 275
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1429 + 30100834-30102261
          Length = 475

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -1

Query: 412 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 275
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1425 + 30084383-30085810
          Length = 475

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -1

Query: 412 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 275
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_03_1420 - 30053713-30055140
          Length = 475

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = -1

Query: 412 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 275
           +PP   L      +L+ GD+R+  V  LH W+E     R YR   +S
Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171


>06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764
          Length = 640

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = -1

Query: 340 TTLHAWNETPCARRYY 293
           TT  AW ETPCA R++
Sbjct: 560 TTTEAWVETPCAHRFH 575


>01_06_1406 -
           37073548-37073822,37073892-37074111,37074200-37074246,
           37074404-37074576,37075161-37075238,37075751-37075813,
           37075889-37075961,37076150-37076189,37076302-37076368,
           37076719-37078472,37079128-37079230,37080041-37080078,
           37080221-37080347,37081944-37082152
          Length = 1088

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +3

Query: 348 RKRSSPFKTPA*SGSRTLPGGEFDWGGTSV 437
           +KR  P K PA S S+ LPG + + G  SV
Sbjct: 339 KKRGRPRKYPAPSNSKHLPGTDTELGNDSV 368


>03_02_0740 -
           10836752-10837052,10837756-10837814,10837901-10838476,
           10839965-10841686,10841776-10842173,10842264-10842318,
           10842989-10843048,10843444-10843540,10844885-10844955,
           10845029-10845109,10846054-10846124,10847951-10848119,
           10848521-10848683,10848752-10848942,10849037-10849168
          Length = 1381

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 12/24 (50%), Positives = 16/24 (66%)
 Frame = -1

Query: 427 PPQSNSPPGSVLEPDHAGVLNGDE 356
           P  +NS P +V +PD   +LNGDE
Sbjct: 739 PTSNNSVPQNVDQPDSKKMLNGDE 762


>02_02_0406 - 9888167-9888570,9890168-9890248,9892207-9892600
          Length = 292

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = +1

Query: 364 RLKLPRDPVRGHCQAGSLTGAVHLSKNNAGVLRPAQRGQKPRVEQKGKTGLIQMFSTHRD 543
           RL+ P     G C A ++  A  +S    G++ PA+  ++P   ++     +   ++ R+
Sbjct: 30  RLRRPLAAAAGACVAAAVAAAAGVS---LGIVFPAEPAERPFCRERRMLEALPAAASSRE 86

Query: 544 CENTAYR 564
            E  AYR
Sbjct: 87  EEPEAYR 93


>01_07_0197 +
           41912207-41912652,41913226-41913800,41913828-41915748,
           41915836-41916049,41916143-41916394,41916469-41916528,
           41916646-41916776,41916898-41917012,41917084-41917239
          Length = 1289

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%)
 Frame = +3

Query: 573 YKEFLARG-ARKVTTGITGLWQPSVHSDVAF*SS 671
           YK F A G  RKV  GIT  + PS+  D+AF S+
Sbjct: 633 YKIFQAFGLVRKVEKGITRWYYPSMLDDLAFDSA 666


>12_02_0077 - 13288916-13289659,13289689-13289691
          Length = 248

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = -2

Query: 162 ESSSTGSSFPADSPKPVPLAVVSLDSR 82
           ++ S G S P DS + VP+ VV+L  R
Sbjct: 3   DNQSLGKSLPKDSRRHVPVGVVALKKR 29


>09_02_0221 +
           5962606-5963197,5963711-5963837,5963994-5964100,
           5964185-5964328,5964700-5964822,5964921-5965103,
           5965540-5965718,5965797-5965823
          Length = 493

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 26/87 (29%), Positives = 34/87 (39%)
 Frame = -2

Query: 321 TKHRAPADIIDRAPLPPNRVSNEQ*K*WFFSDDRAKRSPTYATPLMSPYNARLESSSTGS 142
           +KH + +    RAP  P R S EQ                Y TP  + Y A   SSS GS
Sbjct: 273 SKHASSSTPSSRAPSAPQRSSFEQ-------------KTNYQTPASALYGAYEGSSSQGS 319

Query: 141 SFPADSPKPVPLAVVSLDSR*GQWESR 61
           S     P   P+A++    +    E R
Sbjct: 320 SSGYGEPPKDPVALMEFYMKKAAQEER 346


>08_02_1371 + 26493981-26494471,26497374-26497504,26497947-26498692
          Length = 455

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)
 Frame = +1

Query: 271 GRKRCAVD-NIGGRTVFRSKRAEW*RGGNARRRLKLPRDPVRGHCQAGSLTGAVHLSKNN 447
           GR+ C+VD  +GG   F         GG A+ R+ +  +P +G   A + TGA   + ++
Sbjct: 48  GRQECSVDLKLGGLGEFG--------GGGAQPRVAVAGEPAKGKGPAAAATGAA-AAASS 98

Query: 448 AGVLRP 465
           A   RP
Sbjct: 99  APAKRP 104


>06_01_0437 +
           3101449-3101521,3101872-3102232,3103766-3103958,
           3104051-3104848,3104997-3105143,3106024-3106377
          Length = 641

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 2/43 (4%)
 Frame = +1

Query: 304 GRTVFRSKR--AEW*RGGNARRRLKLPRDPVRGHCQAGSLTGA 426
           G+T+ R  R  A W RG  A RR +LP     G  +AG   G+
Sbjct: 36  GQTLTRGPRTCAVWRRGRAAVRRRRLPAASAEGGAKAGRSLGS 78


>04_01_0416 -
           5504415-5504590,5509032-5509116,5509190-5509322,
           5509426-5510312
          Length = 426

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 17/36 (47%), Positives = 20/36 (55%)
 Frame = -2

Query: 192 PLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDS 85
           PL+ P  AR   SSTGSSFP  S  P    ++ L S
Sbjct: 47  PLIHPTPARF-ISSTGSSFPPYSEPPPSAPMLELGS 81


>03_02_0474 -
           8759585-8759626,8759753-8759893,8760001-8760093,
           8760194-8760352
          Length = 144

 Score = 27.9 bits (59), Expect = 8.7
 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 2/30 (6%)
 Frame = -3

Query: 689 DRKSRHRGSKSNVAMNAWLPQAS--YPCGN 606
           D   RH   K N A N W+P A   YP  +
Sbjct: 108 DASERHASCKGNPATNEWIPSADTVYPASD 137


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,337,053
Number of Sequences: 37544
Number of extensions: 490933
Number of successful extensions: 1589
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 1534
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1585
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1898162308
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).