SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0090
         (604 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_1055 - 27234824-27234838,27236087-27236125,27236322-272373...    31   0.93 
02_04_0276 + 21491150-21492761,21492891-21492947,21493817-214938...    30   1.2  
07_03_0846 - 21983581-21986055                                         29   2.1  
01_07_0197 + 41912207-41912652,41913226-41913800,41913828-419157...    29   2.1  
03_05_0951 + 29093962-29094373,29095291-29095388,29095689-290960...    28   6.5  
10_06_0105 - 10790092-10790323,10791092-10791234,10791322-107914...    27   8.7  
06_01_0107 - 854756-854883,855126-856968                               27   8.7  
03_05_0823 - 27970038-27970258,27970279-27970544,27970608-279706...    27   8.7  
02_01_0083 - 566201-567127,567223-567464,567623-567880,568173-56...    27   8.7  
01_06_1777 + 39818212-39819696                                         27   8.7  

>06_03_1055 -
           27234824-27234838,27236087-27236125,27236322-27237388,
           27237422-27237630,27237650-27238053
          Length = 577

 Score = 30.7 bits (66), Expect = 0.93
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = -2

Query: 231 ASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGS 97
           A+ A +GK +   E  E   S+QCD T  + +S RE ++R+P+ +
Sbjct: 430 AAAAAAGKPISEHEAIEHLWSRQCDLTEILQNSSRE-KKRNPYAA 473


>02_04_0276 +
           21491150-21492761,21492891-21492947,21493817-21493870,
           21493994-21494022
          Length = 583

 Score = 30.3 bits (65), Expect = 1.2
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 4/63 (6%)
 Frame = -2

Query: 318 RTFGSCTRPSGRWCEATIRGISLNASKAEAS--LAESGKDMLTVEPRESG--GSKQCDFT 151
           R  GS  RP    C A I+ +S +   AEA   LA  G D++      +G  G+ Q D  
Sbjct: 86  RLVGSARRPDAGTCAALIKKLSASGRTAEARRVLAACGPDVMAYNAMVAGYCGAGQLDAA 145

Query: 150 SRV 142
            R+
Sbjct: 146 RRL 148


>07_03_0846 - 21983581-21986055
          Length = 824

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +2

Query: 89  DLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASA 238
           DL+D  G  +R    +C+T    S     PD   S VS+ LPD+A+ A A
Sbjct: 326 DLQDFTGGCKRNVPLQCQTN--SSSAQTQPDKFYSMVSVRLPDNAQSAVA 373


>01_07_0197 +
           41912207-41912652,41913226-41913800,41913828-41915748,
           41915836-41916049,41916143-41916394,41916469-41916528,
           41916646-41916776,41916898-41917012,41917084-41917239
          Length = 1289

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 17/32 (53%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = -1

Query: 589 YKEFLARG-ARKVTTGITGLWQPSVHSDLLFD 497
           YK F A G  RKV  GIT  + PS+  DL FD
Sbjct: 633 YKIFQAFGLVRKVEKGITRWYYPSMLDDLAFD 664


>03_05_0951 +
           29093962-29094373,29095291-29095388,29095689-29096087,
           29096999-29097724,29097802-29097968,29098046-29098311,
           29098396-29098581,29099072-29099346,29099435-29099683
          Length = 925

 Score = 27.9 bits (59), Expect = 6.5
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 2/65 (3%)
 Frame = -2

Query: 240 KAEASLAESGKDMLTVEP-RESGGSKQCDFTSRVSHSKRETR-RRSPFGSRRSMLSVFFL 67
           K+ AS A  G D     P R  GG K+    S  + SKR  + R + F     +L    L
Sbjct: 4   KSSASAAHQGGDAPAEAPRRRGGGGKRKSGGSSFTPSKRHAKERNAAFHVPPHLLHSGPL 63

Query: 66  TRASR 52
           TRA+R
Sbjct: 64  TRAAR 68


>10_06_0105 -
           10790092-10790323,10791092-10791234,10791322-10791429,
           10791796-10791903,10793133-10797686,10798347-10798461,
           10799597-10799724,10799843-10800043,10800158-10800227,
           10801233-10801314,10801433-10801556,10801761-10801778
          Length = 1960

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +2

Query: 254 LIPRMVASHHRPLGRVHEPNVRNCGSSRT 340
           L+P   A+H   LGR H+ N +  GS+ T
Sbjct: 535 LVPPTNAAHQPSLGRDHDSNKKTSGSAGT 563


>06_01_0107 - 854756-854883,855126-856968
          Length = 656

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 15/39 (38%), Positives = 17/39 (43%)
 Frame = -3

Query: 563 QKSYHRDNWLVAAKRS*RLAF*SFDVGSSYHCEAKFAKR 447
           + S H D+WL  A  S RL     D     H EA  A R
Sbjct: 205 ESSPHGDDWLTLAAASSRLLVRGLDAAPVLHLEAHHAGR 243


>03_05_0823 -
           27970038-27970258,27970279-27970544,27970608-27970657,
           27971272-27971538,27971633-27972001,27972373-27973278
          Length = 692

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 32/104 (30%), Positives = 44/104 (42%), Gaps = 4/104 (3%)
 Frame = +2

Query: 17  RHRTELYPDLRSR-DARVKKKTDSIDLRDPNGLRRRVSRFECET--RLVKSHCLEPPDSR 187
           RH   L  ++RS  D     KT  ++L    GL          +   L  SH L    + 
Sbjct: 144 RHVRMLTHEIRSTLDRHTILKTTLVELGGTLGLEECALWMPSRSGSSLQLSHTLRHQITV 203

Query: 188 GSTVSISLPDSARLASALEAFRLIPRMVASHHRPL-GRVHEPNV 316
           GSTVSI+LP   ++ S+  A  +      +  RPL GR   P V
Sbjct: 204 GSTVSINLPVVNQVFSSNRAIIIPHTSPLARIRPLAGRYVPPEV 247


>02_01_0083 -
           566201-567127,567223-567464,567623-567880,568173-568298,
           568420-568489
          Length = 540

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/35 (34%), Positives = 19/35 (54%)
 Frame = -3

Query: 212 ARICSLWSPESREALNNVTLLVAFRIQNARRDVEA 108
           AR C  W PESR  ++ V  ++A    ++R+   A
Sbjct: 449 ARECLQWEPESRPTMSEVVQILATIAPSSRKHAAA 483


>01_06_1777 + 39818212-39819696
          Length = 494

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%)
 Frame = +2

Query: 182 SRGSTVSISLPDSARLASALEAFRLIPRMVASHHRP-LGRVHEPNVRNCGSSRT 340
           +R  T SI +      +  ++A +++ RMV  HHRP  G  +      C + RT
Sbjct: 399 TRKETFSILISGLCSESRFIDAAQIMERMVKGHHRPEAGEFNNVIEGLCSAGRT 452


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,558,631
Number of Sequences: 37544
Number of extensions: 346523
Number of successful extensions: 973
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 957
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 973
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1431112012
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).