SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0088
         (672 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_04_0593 - 18825741-18826702,18826994-18827875,18828687-188287...    39   0.003
06_03_1055 - 27234824-27234838,27236087-27236125,27236322-272373...    32   0.48 
07_03_0846 - 21983581-21986055                                         29   2.6  
06_02_0173 - 12601025-12601071,12601632-12601698,12601857-126019...    29   3.4  
03_05_0951 + 29093962-29094373,29095291-29095388,29095689-290960...    29   3.4  
03_05_0183 - 21681673-21682524                                         29   3.4  
06_01_0655 + 4742267-4742531,4743313-4744136                           28   5.9  
11_06_0715 + 26552962-26553510,26553578-26555746                       28   7.8  
09_04_0235 + 15904891-15905218,15906732-15907594                       28   7.8  
08_02_1485 - 27466761-27467753                                         28   7.8  
08_02_1081 + 24215323-24215335,24215450-24215572,24216241-242164...    28   7.8  
01_06_1164 - 35026345-35026954,35027853-35027939,35028120-350284...    28   7.8  

>09_04_0593 -
           18825741-18826702,18826994-18827875,18828687-18828775,
           18828942-18829080,18829405-18829531,18829629-18829838
          Length = 802

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 28/88 (31%), Positives = 46/88 (52%), Gaps = 1/88 (1%)
 Frame = -1

Query: 300 VREEPQFRTFGSCTRRAAGGAKLP-SAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 124
           +++EP+FR F     R  G A  P +AG+  N + A +++++S K  +  E   SG    
Sbjct: 691 IKDEPEFRAFTGSGNRLDGKASKPLAAGISSNPAAASSAISDSNK-KVNQETAASG---- 745

Query: 123 CDFTSRVSHSKREKRRRSPFGSRRSMLS 40
                 VS+S R+K+ +  FGS +S  S
Sbjct: 746 ------VSNSTRQKKGKLVFGSNKSSSS 767


>06_03_1055 -
           27234824-27234838,27236087-27236125,27236322-27237388,
           27237422-27237630,27237650-27238053
          Length = 577

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 17/45 (37%), Positives = 27/45 (60%)
 Frame = -1

Query: 192 ASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKREKRRRSPFGS 58
           A+ A +GK +   E  E   S+QCD T  + +S REK +R+P+ +
Sbjct: 430 AAAAAAGKPISEHEAIEHLWSRQCDLTEILQNSSREK-KRNPYAA 473


>07_03_0846 - 21983581-21986055
          Length = 824

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +2

Query: 50  DLRDPNGLRRRFSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASA 199
           DL+D  G  +R    +C+T    S     PD   S VS+ LPD+A+ A A
Sbjct: 326 DLQDFTGGCKRNVPLQCQTN--SSSAQTQPDKFYSMVSVRLPDNAQSAVA 373


>06_02_0173 -
           12601025-12601071,12601632-12601698,12601857-12601934,
           12602235-12602396,12603309-12603440,12604604-12604656,
           12605808-12606372
          Length = 367

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 19/74 (25%), Positives = 31/74 (41%), Gaps = 2/74 (2%)
 Frame = +2

Query: 116 KSHCLEPPDSRGSTVSISLPDSARLASALEAFRHNPADGSFAPPAARRVHEPNVRNCGS- 292
           KS  L+P    G+  ++ L   A     +  ++H P    +  PAA     P VR  G  
Sbjct: 22  KSGALQPQPPHGAAAAVRL---AYTHDGIAVYKHTPPPPVYQTPAAVAAPSPPVRGNGGA 78

Query: 293 -SRTEQYYYRNDKP 331
            +  EQ+  +  +P
Sbjct: 79  PASAEQHKRKRGRP 92


>03_05_0951 +
           29093962-29094373,29095291-29095388,29095689-29096087,
           29096999-29097724,29097802-29097968,29098046-29098311,
           29098396-29098581,29099072-29099346,29099435-29099683
          Length = 925

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 24/65 (36%), Positives = 30/65 (46%), Gaps = 2/65 (3%)
 Frame = -1

Query: 201 KAEASLAESGKDMLTVEP-RESGGSKQCDFTSRVSHSKRE-KRRRSPFGSRRSMLSVFFL 28
           K+ AS A  G D     P R  GG K+    S  + SKR  K R + F     +L    L
Sbjct: 4   KSSASAAHQGGDAPAEAPRRRGGGGKRKSGGSSFTPSKRHAKERNAAFHVPPHLLHSGPL 63

Query: 27  TRASR 13
           TRA+R
Sbjct: 64  TRAAR 68


>03_05_0183 - 21681673-21682524
          Length = 283

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 12/27 (44%), Positives = 18/27 (66%)
 Frame = -3

Query: 490 SQAFIATLLFDPSMSALPIIAKQNSPS 410
           SQAF A LL D + +A+P++  Q  P+
Sbjct: 229 SQAFSAVLLADANRAAIPVVVVQKRPA 255


>06_01_0655 + 4742267-4742531,4743313-4744136
          Length = 362

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 24/93 (25%), Positives = 37/93 (39%), Gaps = 4/93 (4%)
 Frame = +2

Query: 50  DLRDPN-GLRRRFSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASALEAFRHNPA 226
           ++RDP  G+R     F       +++  E    RG    ++ PD A +AS     R +  
Sbjct: 129 EIRDPRKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVNFPDGAPVASQ----RSHAE 184

Query: 227 DGSFAPPAARRVHEPNVRNCGSS---RTEQYYY 316
             S   PA     +P V + G+     T  Y Y
Sbjct: 185 PSSMNMPAFSIEEKPAVMSAGNKTMYNTNAYAY 217


>11_06_0715 + 26552962-26553510,26553578-26555746
          Length = 905

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 16/42 (38%), Positives = 21/42 (50%)
 Frame = +2

Query: 404 SNAWRILLRNDRKSRHRRIKKQRRYERLAATSQLSCGNFSGT 529
           S+   +L  N  K  H  +KK R   RLA T  LSC   +G+
Sbjct: 728 SDEEEVLQLNGLKWLHPNVKKLRLIGRLAQTGLLSCAPEAGS 769


>09_04_0235 + 15904891-15905218,15906732-15907594
          Length = 396

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 1/67 (1%)
 Frame = +2

Query: 50  DLRDPN-GLRRRFSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASALEAFRHNPA 226
           ++RDP+ G+R     +       +++  E    RG    ++ PD   +A  L   ++   
Sbjct: 150 EIRDPSKGVRVWLGTYNTAEEAARAYDAEARKIRGKKAKVNFPDEPAVAQKLSLKQNAAK 209

Query: 227 DGSFAPP 247
               APP
Sbjct: 210 QEKLAPP 216


>08_02_1485 - 27466761-27467753
          Length = 330

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +2

Query: 134 PPDSRGSTVSISLPDSARLASALEAFRHNPADGSFAPPAAR 256
           PP + G  +S  +P  A LA++L  +  NPA     PP ++
Sbjct: 39  PPSATGPVLSRDVPLDASLATSLRLYLPNPASPP-PPPTSK 78


>08_02_1081 +
           24215323-24215335,24215450-24215572,24216241-24216489,
           24218517-24218720,24218864-24218993,24219610-24219679,
           24219766-24219900,24219996-24220209,24220314-24220455,
           24220630-24220851,24220997-24221195
          Length = 566

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 14/33 (42%), Positives = 17/33 (51%)
 Frame = -1

Query: 141 SGGSKQCDFTSRVSHSKREKRRRSPFGSRRSML 43
           S G+ Q   T R  HS  E+RRRS    R  +L
Sbjct: 212 SAGTDQMPNTPRSKHSATEQRRRSKINDRFQLL 244


>01_06_1164 - 35026345-35026954,35027853-35027939,35028120-35028493,
            35037372-35038586,35038659-35039316,35039331-35041012
          Length = 1541

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = +2

Query: 143  SRGSTVSISLPDSAR-LASALEAFRHNPADGSFAPPAARRVHEPNV 277
            SR  TV +S+  SA   AS  +     PAD + +PP  R   E NV
Sbjct: 1262 SRAFTVCLSIMASASPSASPPQPDETPPADSAVSPPPPRAAREDNV 1307


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,053,047
Number of Sequences: 37544
Number of extensions: 410648
Number of successful extensions: 1167
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1146
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1165
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1703141568
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).