SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0086
         (739 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764           33   0.31 
06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,890...    31   1.3  
02_05_0110 + 25914110-25915006,25915726-25915797,25916411-259166...    30   2.2  
12_02_0423 + 18944555-18945226,18945309-18945545                       29   2.9  
10_08_0190 + 15607241-15607409,15607932-15607990,15608883-156089...    29   2.9  
08_01_0516 - 4499797-4499949,4500040-4500617,4500699-4500756,450...    29   2.9  
08_01_0025 - 184899-185384,185707-185940,187156-187341,188108-18...    28   6.7  
12_02_0827 + 23492583-23492633,23493018-23493566,23493722-23494012     28   8.9  
11_06_0667 + 26071774-26072070,26072352-26073153,26073209-260734...    28   8.9  
06_01_0476 - 3388176-3389267                                           28   8.9  

>06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764
          Length = 640

 Score = 32.7 bits (71), Expect = 0.31
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = -2

Query: 738 LNGDERSGHVTTLHAWNETPCARRYY 661
           L+G    G  TT  AW ETPCA R++
Sbjct: 550 LDGGGGGGEKTTTEAWVETPCAHRFH 575


>06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,
            8905437-8905690,8905785-8908799,8908889-8909001,
            8909975-8910164,8910399-8910512,8910591-8910698,
            8910941-8911073,8911206-8911408,8911626-8911826
          Length = 1889

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 20/66 (30%), Positives = 31/66 (46%)
 Frame = +2

Query: 380  GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKRPC*A*L*SGIVRRHER 559
            G+  PR +  D  EW N  PT+   ++ + +PRE     Q+ K P        I+   E 
Sbjct: 1393 GNCAPRTVECDEGEWYNNFPTIDENHVQRNKPREEQIFQQKLK-PA-----IFILNSDES 1446

Query: 560  CSISGR 577
            CS+ G+
Sbjct: 1447 CSLKGK 1452


>02_05_0110 +
           25914110-25915006,25915726-25915797,25916411-25916699,
           25916864-25916949,25917267-25917490,25917674-25917740,
           25917830-25917889,25917995-25918078,25918475-25918555
          Length = 619

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = -3

Query: 404 LDDEAFGYL-KRVIVTPAVYPRLLEFLHVDIQSTG 303
           LDDE   YL  R  V   +  RLL+F++VD  STG
Sbjct: 279 LDDEDISYLTNRAAVYIEMGKRLLKFIYVDPSSTG 313


>12_02_0423 + 18944555-18945226,18945309-18945545
          Length = 302

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +3

Query: 231 GESDCLIKQSIAMALAGVDAM*FLPSALNVNVKKFKQA 344
           GE  CL+  S+  A+A  DAM     AL+ +V +FK +
Sbjct: 258 GEGRCLVPTSLVRAIADDDAMATSNPALSRDVNRFKDS 295


>10_08_0190 +
           15607241-15607409,15607932-15607990,15608883-15608991,
           15609394-15609551,15609976-15610044,15610158-15610847,
           15611112-15611629,15611725-15611789,15613010-15613089,
           15613894-15613998,15614768-15614881,15615029-15615168,
           15615257-15615385,15615903-15616055,15616186-15616327
          Length = 899

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = -1

Query: 361 LPP-FTRACLNFFTLTFRALGRNHIASTPARAIAMLCLIRQSDSPCP 224
           LPP F+   ++F   T R + R H+   P R +A++CL+  S+ P P
Sbjct: 59  LPPSFSSVTMDF--ATDRDIQREHLKDLPRRDLAIICLM-NSNPPIP 102


>08_01_0516 -
           4499797-4499949,4500040-4500617,4500699-4500756,
           4500855-4500932,4501032-4501091,4501219-4501332,
           4501436-4501594
          Length = 399

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 5/89 (5%)
 Frame = -3

Query: 590 SRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKPVPLAVVSLDSR*GQW---ESR*SI 420
           SR  ++HL     ++   Q    +NR S PA  P P+   VV+ +    QW   + R + 
Sbjct: 120 SRMKLAHL--EQEITRARQQSAYINRSSNPATLPAPIDSGVVTFEVEYAQWVEEQGRQTA 177

Query: 419 HARH*LDDEAFGYLKRVIVTPAV--YPRL 339
             R  L   A G   R +V  A+  Y RL
Sbjct: 178 ELRASLQAAAEGPELRAVVEAALAHYDRL 206


>08_01_0025 -
           184899-185384,185707-185940,187156-187341,188108-188158
          Length = 318

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = -2

Query: 267 SQCFV*LDSRIPLVRASSELTVERRSYRIVPIAHETKPTRP 145
           + C   LD+ IP+ R   E + E R   I+P  +   P+ P
Sbjct: 268 ADCSPGLDNEIPITRTKIESSSEVRDLEILPTGNAALPSSP 308


>12_02_0827 + 23492583-23492633,23493018-23493566,23493722-23494012
          Length = 296

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 23/85 (27%), Positives = 38/85 (44%)
 Frame = +3

Query: 135 PSRKVVSVSFRARSARFCTTAVQRSAQNWHGQGESDCLIKQSIAMALAGVDAM*FLPSAL 314
           P   VVS+S RAR AR      + +A       E   L+ Q + +A+A    +  LP  L
Sbjct: 70  PRPAVVSMSERARLARVAAAGARHAAVPALRLDEHQVLLLQQL-LAVAAAPLLQGLPPLL 128

Query: 315 NVNVKKFKQARVNGGSNYDSLKVAK 389
           +   ++ +   V GG   ++ +  K
Sbjct: 129 DAR-RRVRNVPVGGGCRRNTKRSTK 152


>11_06_0667 + 26071774-26072070,26072352-26073153,26073209-26073411,
            26075078-26075521,26075703-26075758,26076323-26076402,
            26077098-26077174,26077279-26078301
          Length = 993

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 21/90 (23%), Positives = 40/90 (44%)
 Frame = +3

Query: 21   ILI*CGLKNCIYLI*HSRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAV 200
            I + C    C+ +           +++RTR L+P++D+ +  VV +   +     C    
Sbjct: 847  IAVSCDEAECVDICVRGTLGYLDPEFVRTRTLKPASDVYNFGVVMLEVLSGRRAIC---- 902

Query: 201  QRSAQNWHGQGESDCLIKQSIAMALAGVDA 290
             R  ++ HG G+ D  +   +  AL  +DA
Sbjct: 903  -RWKED-HGDGDGDSPMDSLVNHALPLIDA 930


>06_01_0476 - 3388176-3389267
          Length = 363

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 2/87 (2%)
 Frame = +3

Query: 345 RVNGGSNYDSLKVAKCLVI*LVTRMNGLTRFPLSLSTI*RNHSQGNGLGRISG--ERDPV 518
           R  G S+  SL   +C    + +    L    L +S + R H  GNG  R+ G    +P 
Sbjct: 244 REEGESSSSSLDARRCFS--MGSYQYVLAEASLQVS-VHRRHGDGNGRARLRGLAGANPA 300

Query: 519 ELDSSLAL*GDMRGVA*VGDRFARSSL 599
             D++ A  G   G    GD F+ S +
Sbjct: 301 GNDAAAAADGKKIGAGSKGDSFSVSKI 327


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,751,064
Number of Sequences: 37544
Number of extensions: 451533
Number of successful extensions: 1208
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1181
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1208
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1945321620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).