SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0085
         (691 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_06_0002 + 9382559-9382937,9383008-9383180,9386752-9386901,938...    30   2.0  
03_03_0053 + 14109636-14109948,14110075-14110302,14112030-141121...    29   3.5  
03_03_0090 + 14367033-14367279,14367402-14368205,14368314-143700...    28   6.1  
04_01_0178 + 2006369-2006494,2006582-2006664,2007693-2007819,200...    28   8.0  

>10_06_0002 + 9382559-9382937,9383008-9383180,9386752-9386901,
            9387180-9387325,9387416-9387572,9387720-9387778,
            9388204-9388360,9389001-9389150,9389280-9389416,
            9390071-9390217,9390292-9390393,9390742-9390799,
            9391997-9392034,9392124-9392250,9392320-9392493,
            9393125-9393256,9393940-9394049,9394752-9394812,
            9395036-9395213,9395326-9395531,9395796-9395915,
            9396496-9396594,9396983-9397204,9397482-9397621,
            9397741-9397852,9398021-9398071,9398151-9398240,
            9398397-9398567,9398663-9398815,9399774-9399950,
            9400045-9400182,9400295-9400365,9400739-9400838,
            9401324-9401380,9401469-9401525,9401619-9401699,
            9401782-9401864,9401975-9402110
          Length = 1632

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 17/65 (26%), Positives = 31/65 (47%)
 Frame = +3

Query: 300  CRPTSTLTEEHRDRILILNRRFLERRLTDDMLRKRVSITADACTDSAAHKCNYELFNRNN 479
            C    +  +   D+ L+L R+  +      MLR    +TA+A  +++  K   E  ++NN
Sbjct: 1045 CAAAKSAAQSEHDKNLLLQRQLDDSLREITMLRSSKIMTAEAERENSNLKNLVESLSKNN 1104

Query: 480  FSIRY 494
             S+ Y
Sbjct: 1105 SSLEY 1109


>03_03_0053 +
           14109636-14109948,14110075-14110302,14112030-14112181,
           14112305-14112578,14112687-14112739
          Length = 339

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +2

Query: 158 PVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSTFLARFEHS 280
           P+  +  YLG+   NK+ P+ Y +  C K+ + F     H+
Sbjct: 248 PIGCVPGYLGIFP-NKLSPKDYDVFGCIKWLNDFSKYHNHA 287


>03_03_0090 +
           14367033-14367279,14367402-14368205,14368314-14370039,
           14370135-14370219,14370398-14370457,14370744-14370836
          Length = 1004

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +2

Query: 170 INHYLGVLKTNKIEPRSYSIIPCTKYSSTFLARFE 274
           I H L +LK  KI P   +I  C +YS   ++ F+
Sbjct: 819 ILHALHILKAEKIFPTESNIADCIRYSEMNISGFD 853


>04_01_0178 +
           2006369-2006494,2006582-2006664,2007693-2007819,
           2008579-2008638,2009606-2009735,2009821-2010047,
           2010226-2010318,2010395-2010466,2011392-2011532,
           2012045-2012047,2012387-2012443,2012909-2012995,
           2013081-2013116
          Length = 413

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 19/59 (32%), Positives = 24/59 (40%)
 Frame = +2

Query: 146 IRMPPVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSTFLARFEHSNLFKVKLSAHLDTH 322
           I+M P  P  H+L     N     +    P   YSST    F H+N F   +   L TH
Sbjct: 53  IKMVPPGP--HFLYYCSPNSYGQNNLHEKPHIDYSSTICDPFRHANEFAPTVGFFLTTH 109


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,266,992
Number of Sequences: 37544
Number of extensions: 371337
Number of successful extensions: 857
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 834
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 857
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1756684372
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).