SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0081
         (629 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0861 + 8153108-8153266,8154633-8155136                           30   1.3  
06_02_0092 - 11624905-11625123,11625206-11625292,11625767-116258...    28   7.0  
04_03_0946 + 20975955-20976095,20976189-20976330,20976449-209765...    28   7.0  
03_04_0201 - 18409088-18409306,18409389-18409475,18409950-184100...    28   7.0  
01_05_0005 - 16886553-16886946,16887079-16887404                       28   7.0  
11_01_0515 + 4003167-4003229,4003318-4003738,4004224-4004367,400...    27   9.3  
08_01_0566 - 5028512-5029150                                           27   9.3  
03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340...    27   9.3  
03_02_0578 + 9603118-9605633,9605766-9605781                           27   9.3  

>12_01_0861 + 8153108-8153266,8154633-8155136
          Length = 220

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = -3

Query: 495 PITRPRKSPVSLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNP--DSPLPVTTMVV 322
           P ++ R +P SL    +     G   RL  S  +VA+ + P P S+P  D P   TT+ +
Sbjct: 86  PSSQLRAAPRSLLSSPSPHCQEGHDPRLCVSAGLVAIPRCPPPTSSPSLDPPESSTTVAL 145

Query: 321 AE 316
            E
Sbjct: 146 IE 147


>06_02_0092 -
           11624905-11625123,11625206-11625292,11625767-11625889,
           11625992-11626351,11626427-11626511,11626603-11626661,
           11627173-11627265,11627360-11627464,11627539-11627636,
           11627811-11627916,11628009-11628131,11628986-11629021,
           11629113-11629310,11629415-11629612,11629917-11630056,
           11630181-11630322,11630416-11630556
          Length = 770

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = -3

Query: 465 SLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTM 328
           ++ F T S +GS  F+R+  + DVV + +A     +P   LP T +
Sbjct: 428 AIVFSTLSFSGSSIFSRMARAFDVVIIDEAAQAVGDP-VQLPATVI 472


>04_03_0946 +
           20975955-20976095,20976189-20976330,20976449-20976588,
           20976893-20977090,20977195-20977392,20977484-20977519,
           20978374-20978496,20978589-20978694,20978869-20978966,
           20979041-20979145,20979240-20979332,20979842-20979900,
           20979984-20980068,20980144-20980503,20980606-20980728,
           20981203-20981289,20981372-20981590
          Length = 770

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = -3

Query: 465 SLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTM 328
           ++ F T S +GS  F+R+  + DVV + +A     +P   LP T +
Sbjct: 428 AIVFSTLSFSGSSIFSRMARAFDVVIIDEAAQAVGDP-VQLPATVI 472


>03_04_0201 -
           18409088-18409306,18409389-18409475,18409950-18410072,
           18410175-18410534,18410610-18410694,18410780-18410838,
           18411350-18411442,18411537-18411641,18411716-18411813,
           18411988-18412093,18412186-18412308,18413163-18413198,
           18413290-18413487,18413592-18413789,18414094-18414233,
           18414356-18414497,18414591-18414731
          Length = 770

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = -3

Query: 465 SLFFVTTSRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTM 328
           ++ F T S +GS  F+R+  + DVV + +A     +P   LP T +
Sbjct: 428 AIVFSTLSFSGSSIFSRMARAFDVVIIDEAAQAVGDP-VQLPATVI 472


>01_05_0005 - 16886553-16886946,16887079-16887404
          Length = 239

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -1

Query: 599 RNNFSIRYWSWNYRGC 552
           R+N S RYW W   GC
Sbjct: 90  RSNSSFRYWRWQPHGC 105


>11_01_0515 +
           4003167-4003229,4003318-4003738,4004224-4004367,
           4004474-4004556,4004661-4004775,4005309-4005400,
           4005558-4005612,4005689-4005834,4005888-4006001,
           4006149-4006342,4006985-4007112,4008526-4008583,
           4009800-4009876,4010214-4010263,4010336-4010515,
           4010633-4010731,4010816-4011133,4011221-4011281,
           4011693-4012781,4012951-4013005,4013133-4013291,
           4013923-4014442
          Length = 1406

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 10/39 (25%)
 Frame = -2

Query: 475 ESRIVIFRHYLPCREWVICA----------PAAFLGCGS 389
           +SR++IF HY  C + ++C+          PAAF+G  S
Sbjct: 524 DSRVIIFAHYRECVKEILCSLRNIDGELVRPAAFIGQSS 562


>08_01_0566 - 5028512-5029150
          Length = 212

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 14/38 (36%), Positives = 19/38 (50%)
 Frame = -3

Query: 294 GRHLKDASPVLDHGSAKVIQIHQN*RLRTRGPPSIGFD 181
           GRHL+D   + ++G  K   +H   RLR  G    G D
Sbjct: 47  GRHLEDGRTLAEYGIKKEANLHLALRLRGGGAAGGGGD 84


>03_06_0399 -
           33632811-33633107,33633236-33633385,33633705-33634029,
           33635315-33635982,33636967-33637212,33637405-33637545,
           33637807-33637856,33637943-33638060,33638304-33638910,
           33639339-33639463,33639813-33639869,33639952-33640023,
           33640100-33640232,33640305-33640428,33640522-33640576,
           33640672-33641322
          Length = 1272

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = -3

Query: 408 PSLDVVAVSQAPSPESNPDSPLP 340
           P LD   ++Q PSP +NP  P P
Sbjct: 55  PPLDEETLAQFPSPPTNPSPPPP 77


>03_02_0578 + 9603118-9605633,9605766-9605781
          Length = 843

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = -1

Query: 506 VYSFRLRGLVRVPYRYFSSLPPVPGVGNLRAC 411
           VY +  +G +R  + Y S LPP+P    L AC
Sbjct: 581 VYEYMAKGTLR-SHLYGSDLPPLPWKQRLEAC 611


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,925,408
Number of Sequences: 37544
Number of extensions: 368513
Number of successful extensions: 973
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 954
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 973
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1537558360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).