SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0079
         (617 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_01_0486 - 3495792-3496034,3496862-3496934,3497128-3497422,349...    32   0.42 
06_03_1055 - 27234824-27234838,27236087-27236125,27236322-272373...    31   0.97 
08_02_1007 - 23495941-23496486,23496933-23497094,23497184-234973...    29   2.2  
07_03_0846 - 21983581-21986055                                         29   2.2  
02_04_0276 + 21491150-21492761,21492891-21492947,21493817-214938...    28   5.2  
02_01_0083 - 566201-567127,567223-567464,567623-567880,568173-56...    28   5.2  
12_01_0017 - 127617-127775,127920-128000,128284-128395,128486-12...    28   6.8  
11_01_0017 - 129261-129335,129352-129426,129565-129645,129929-13...    28   6.8  
09_04_0407 + 17345382-17345579,17345711-17346235                       28   6.8  
03_05_0951 + 29093962-29094373,29095291-29095388,29095689-290960...    28   6.8  
03_05_0823 - 27970038-27970258,27970279-27970544,27970608-279706...    28   6.8  
09_06_0148 - 21214460-21214561,21214993-21215339,21215428-212155...    27   9.0  
03_02_0474 - 8759585-8759626,8759753-8759893,8760001-8760093,876...    27   9.0  

>02_01_0486 -
           3495792-3496034,3496862-3496934,3497128-3497422,
           3497585-3497759,3498349-3498795,3499994-3500053
          Length = 430

 Score = 31.9 bits (69), Expect = 0.42
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = -2

Query: 343 VREEPQFRTFGSCTRPSGRWCEATIRGIMPNAS-KAEASLAESGKDMLTVEPRESGGSKQ 167
           +   P     G   RP+    +++IRGI+P  S KA++SL +  + +L +    S   +Q
Sbjct: 60  ISPSPNSARSGLPPRPNSTRTKSSIRGIIPQRSFKAKSSLQDGDQTILLIPDTPSSSGQQ 119

Query: 166 CDFTSRVSHS 137
              T+  S S
Sbjct: 120 VKATTSRSFS 129


>06_03_1055 -
           27234824-27234838,27236087-27236125,27236322-27237388,
           27237422-27237630,27237650-27238053
          Length = 577

 Score = 30.7 bits (66), Expect = 0.97
 Identities = 16/45 (35%), Positives = 27/45 (60%)
 Frame = -2

Query: 235 ASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGS 101
           A+ A +GK +   E  E   S+QCD T  + +S RE ++R+P+ +
Sbjct: 430 AAAAAAGKPISEHEAIEHLWSRQCDLTEILQNSSRE-KKRNPYAA 473


>08_02_1007 -
           23495941-23496486,23496933-23497094,23497184-23497361,
           23497473-23497882
          Length = 431

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 12/23 (52%), Positives = 15/23 (65%)
 Frame = -3

Query: 297 RAAGGAKLPSAGLCRTPLRPKPA 229
           RA  GA+LP+   CRTP  P P+
Sbjct: 22  RAVVGAQLPTTSPCRTPKSPPPS 44


>07_03_0846 - 21983581-21986055
          Length = 824

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +3

Query: 93  DLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASA 242
           DL+D  G  +R    +C+T    S     PD   S VS+ LPD+A+ A A
Sbjct: 326 DLQDFTGGCKRNVPLQCQTN--SSSAQTQPDKFYSMVSVRLPDNAQSAVA 373


>02_04_0276 +
           21491150-21492761,21492891-21492947,21493817-21493870,
           21493994-21494022
          Length = 583

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 4/63 (6%)
 Frame = -2

Query: 322 RTFGSCTRPSGRWCEATIRGIMPNASKAEAS--LAESGKDMLTVEPRESG--GSKQCDFT 155
           R  GS  RP    C A I+ +  +   AEA   LA  G D++      +G  G+ Q D  
Sbjct: 86  RLVGSARRPDAGTCAALIKKLSASGRTAEARRVLAACGPDVMAYNAMVAGYCGAGQLDAA 145

Query: 154 SRV 146
            R+
Sbjct: 146 RRL 148


>02_01_0083 -
           566201-567127,567223-567464,567623-567880,568173-568298,
           568420-568489
          Length = 540

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = -3

Query: 282 AKLPSAGLC-RTPLRPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNARRDVEA 112
           A+LP   L  R P        + AR C  W PESR  ++ V  ++A    ++R+   A
Sbjct: 426 AELPDPALQGRFPQEEMQIMAHLARECLQWEPESRPTMSEVVQILATIAPSSRKHAAA 483


>12_01_0017 -
           127617-127775,127920-128000,128284-128395,128486-129538,
           129617-129705,130136-130309,130566-130687,130790-130924,
           131132-131494,131561-131728,131850-131889
          Length = 831

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 15/37 (40%), Positives = 19/37 (51%)
 Frame = -1

Query: 533 QPSVHSDVVFDPSMSALPIIAKQNSPSVGLFTHQKGT 423
           Q +  S VV    +SA P   +  SPSVG FT  K +
Sbjct: 302 QDNPSSSVVAPARISAKPSALRMPSPSVGFFTQGKAS 338


>11_01_0017 -
           129261-129335,129352-129426,129565-129645,129929-130040,
           130131-131177,131256-131347,131773-131943,132150-132253,
           132367-132501,132583-132724,132803-133059,133126-133337,
           133417-133454
          Length = 846

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 15/37 (40%), Positives = 19/37 (51%)
 Frame = -1

Query: 533 QPSVHSDVVFDPSMSALPIIAKQNSPSVGLFTHQKGT 423
           Q +  S VV    +SA P   +  SPSVG FT  K +
Sbjct: 321 QDNPSSSVVAPARISAKPSALRMPSPSVGFFTQGKAS 357


>09_04_0407 + 17345382-17345579,17345711-17346235
          Length = 240

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = -1

Query: 287 VVRSYHPRDYAERL*GRSQPSRIRQGYAHCGAP 189
           + + YHP+  A     +S  S IR+ YAHC  P
Sbjct: 4   LAQEYHPKLPATNHYCKSLSSLIRETYAHCHVP 36


>03_05_0951 +
           29093962-29094373,29095291-29095388,29095689-29096087,
           29096999-29097724,29097802-29097968,29098046-29098311,
           29098396-29098581,29099072-29099346,29099435-29099683
          Length = 925

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 2/65 (3%)
 Frame = -2

Query: 244 KAEASLAESGKDMLTVEP-RESGGSKQCDFTSRVSHSKRETR-RRSPFGSRRSMLSVFFL 71
           K+ AS A  G D     P R  GG K+    S  + SKR  + R + F     +L    L
Sbjct: 4   KSSASAAHQGGDAPAEAPRRRGGGGKRKSGGSSFTPSKRHAKERNAAFHVPPHLLHSGPL 63

Query: 70  TRASR 56
           TRA+R
Sbjct: 64  TRAAR 68


>03_05_0823 -
           27970038-27970258,27970279-27970544,27970608-27970657,
           27971272-27971538,27971633-27972001,27972373-27973278
          Length = 692

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 33/104 (31%), Positives = 44/104 (42%), Gaps = 4/104 (3%)
 Frame = +3

Query: 21  RHRTELYPDLRSR-DARVKKKTDSIDLRDPNGLRRRVSRFECET--RLVKSHCLEPPDSR 191
           RH   L  ++RS  D     KT  ++L    GL          +   L  SH L    + 
Sbjct: 144 RHVRMLTHEIRSTLDRHTILKTTLVELGGTLGLEECALWMPSRSGSSLQLSHTLRHQITV 203

Query: 192 GSTVSISLPDSARLASALEAFGIIPRMVASHHRPL-GRVHEPNV 320
           GSTVSI+LP   ++ S+  A  I      +  RPL GR   P V
Sbjct: 204 GSTVSINLPVVNQVFSSNRAIIIPHTSPLARIRPLAGRYVPPEV 247


>09_06_0148 -
           21214460-21214561,21214993-21215339,21215428-21215538,
           21215673-21215835,21215921-21215999,21216110-21216228
          Length = 306

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 19/57 (33%), Positives = 25/57 (43%)
 Frame = -2

Query: 325 FRTFGSCTRPSGRWCEATIRGIMPNASKAEASLAESGKDMLTVEPRESGGSKQCDFT 155
           FR  G+  RP+      T R  M   S    + AE+GK M    P   GG + C F+
Sbjct: 110 FRAHGALLRPAASALTKTPRRKMRGTSDQSPAAAEAGKRMAL--PERLGG-EPCSFS 163


>03_02_0474 -
           8759585-8759626,8759753-8759893,8760001-8760093,
           8760194-8760352
          Length = 144

 Score = 27.5 bits (58), Expect = 9.0
 Identities = 12/30 (40%), Positives = 14/30 (46%), Gaps = 2/30 (6%)
 Frame = +3

Query: 477 DRKSRHRRIKNNVAMNAWLPQAS--YPCGN 560
           D   RH   K N A N W+P A   YP  +
Sbjct: 108 DASERHASCKGNPATNEWIPSADTVYPASD 137


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,650,955
Number of Sequences: 37544
Number of extensions: 380847
Number of successful extensions: 1077
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1050
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1077
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1490248872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).