SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0076
         (634 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_05_0272 - 23738514-23738817,23739382-23740748                       33   0.25 
06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,890...    31   1.0  
02_05_0110 + 25914110-25915006,25915726-25915797,25916411-259166...    31   1.0  
08_01_0516 - 4499797-4499949,4500040-4500617,4500699-4500756,450...    29   2.3  
03_05_1065 + 30061588-30061883,30061995-30062056,30062196-300622...    29   3.1  
06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764           29   4.1  
06_01_0476 - 3388176-3389267                                           28   7.1  
04_01_0396 + 5191653-5191874,5192281-5192396,5192891-5193455           27   9.4  
01_06_0116 - 26595570-26596607,26596964-26598353,26599386-265999...    27   9.4  

>05_05_0272 - 23738514-23738817,23739382-23740748
          Length = 556

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -2

Query: 570 GHLRYS-LTDVPPQSNSPHGSVSNRITREF*TATSVSATSPLCTLGTKH 427
           G  RY+ +TDVPP  N P   V N IT EF T   +   +P  ++ + H
Sbjct: 398 GVFRYNQMTDVPPAVNGPLHVVPNVITAEFRTFIEIIFENPEKSMDSVH 446


>06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,
            8905437-8905690,8905785-8908799,8908889-8909001,
            8909975-8910164,8910399-8910512,8910591-8910698,
            8910941-8911073,8911206-8911408,8911626-8911826
          Length = 1889

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 20/66 (30%), Positives = 31/66 (46%)
 Frame = +3

Query: 126  GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKRPC*A*L*SGIVRRHER 305
            G+  PR +  D  EW N  PT+   ++ + +PRE     Q+ K P        I+   E 
Sbjct: 1393 GNCAPRTVECDEGEWYNNFPTIDENHVQRNKPREEQIFQQKLK-PA-----IFILNSDES 1446

Query: 306  CSISGR 323
            CS+ G+
Sbjct: 1447 CSLKGK 1452


>02_05_0110 +
           25914110-25915006,25915726-25915797,25916411-25916699,
           25916864-25916949,25917267-25917490,25917674-25917740,
           25917830-25917889,25917995-25918078,25918475-25918555
          Length = 619

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
 Frame = -2

Query: 150 LDDEAFGYL-KRVIVTPAVYPRLLEFLHVDIQSTGQKFXL 34
           LDDE   YL  R  V   +  RLL+F++VD  STG    L
Sbjct: 279 LDDEDISYLTNRAAVYIEMGKRLLKFIYVDPSSTGSSVIL 318


>08_01_0516 -
           4499797-4499949,4500040-4500617,4500699-4500756,
           4500855-4500932,4501032-4501091,4501219-4501332,
           4501436-4501594
          Length = 399

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 5/89 (5%)
 Frame = -2

Query: 336 SRETISHLCYTSHVSLQCQTRVKLNRVSFPADSPKPVPLAVVSLDSR*GQW---ESR*SI 166
           SR  ++HL     ++   Q    +NR S PA  P P+   VV+ +    QW   + R + 
Sbjct: 120 SRMKLAHL--EQEITRARQQSAYINRSSNPATLPAPIDSGVVTFEVEYAQWVEEQGRQTA 177

Query: 165 HARH*LDDEAFGYLKRVIVTPAV--YPRL 85
             R  L   A G   R +V  A+  Y RL
Sbjct: 178 ELRASLQAAAEGPELRAVVEAALAHYDRL 206


>03_05_1065 +
           30061588-30061883,30061995-30062056,30062196-30062276,
           30062391-30062464,30062547-30062629,30063044-30063147,
           30063526-30063665,30063736-30063783,30063939-30063991,
           30064178-30064262,30064346-30064412,30064496-30064606,
           30065262-30065283,30066244-30071110,30071186-30071374,
           30071463-30071577,30072329-30073388,30074247-30074694,
           30074966-30075019,30075105-30076898,30076989-30077949,
           30078271-30078384,30078459-30078613,30078934-30079026,
           30079341-30079613,30093423-30093975,30094465-30094540,
           30094619-30094718
          Length = 4025

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 1/64 (1%)
 Frame = -2

Query: 588 LAELALGHLRYSLTDVPPQSNSPHGSVSNRITREF*TA-TSVSATSPLCTLGTKHRAPAD 412
           LA  + GH R+ + D   +  S  G + N+  R +     +VSA + LC +   H AP  
Sbjct: 378 LATTSSGHRRFGMEDEIEEELSLAG-IFNKGDRSYAVRRAAVSAYAALCAVLCAHEAPGG 436

Query: 411 IIDR 400
           + DR
Sbjct: 437 LPDR 440


>06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764
          Length = 640

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = -1

Query: 454 TTXHAWNETPCARRYY 407
           TT  AW ETPCA R++
Sbjct: 560 TTTEAWVETPCAHRFH 575


>06_01_0476 - 3388176-3389267
          Length = 363

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 25/87 (28%), Positives = 37/87 (42%), Gaps = 2/87 (2%)
 Frame = +1

Query: 91  RVNGGSNYDSLKVAKCLVI*LVTRMNGLTRFPLSLSTI*RNHSQGNGLGRISG--ERDPV 264
           R  G S+  SL   +C    + +    L    L +S + R H  GNG  R+ G    +P 
Sbjct: 244 REEGESSSSSLDARRCFS--MGSYQYVLAEASLQVS-VHRRHGDGNGRARLRGLAGANPA 300

Query: 265 ELDSSLAL*GDMRGVA*VGDRFARSSL 345
             D++ A  G   G    GD F+ S +
Sbjct: 301 GNDAAAAADGKKIGAGSKGDSFSVSKI 327


>04_01_0396 + 5191653-5191874,5192281-5192396,5192891-5193455
          Length = 300

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 23/92 (25%), Positives = 36/92 (39%)
 Frame = -2

Query: 597 VSVLAELALGHLRYSLTDVPPQSNSPHGSVSNRITREF*TATSVSATSPLCTLGTKHRAP 418
           VS L ++ +      +   P    S +GS+S  +        S+  T+   T      +P
Sbjct: 86  VSRLRDIIIWGYMLRMRGGPLMVTSQYGSISASLLGIIFLIISLRNTNKGLTSLQSSSSP 145

Query: 417 ADIIDRAPLPPNRVSNETMKVVVFQRRSRETI 322
             + D  PLPP+R+     K  VF     E I
Sbjct: 146 TKLGDGLPLPPSRIHRS--KTTVFGNNDSEDI 175


>01_06_0116 -
           26595570-26596607,26596964-26598353,26599386-26599923,
           26600562-26601453
          Length = 1285

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%)
 Frame = -1

Query: 472 ERFRHVT--TXHAWNETPCARRYYRPRTASAQ 383
           ER RH +  T HA  E P   R  RPRT+S +
Sbjct: 474 ERMRHGSKLTDHAKREIPYDERNIRPRTSSGR 505


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,782,049
Number of Sequences: 37544
Number of extensions: 369195
Number of successful extensions: 952
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 940
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 952
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1549385732
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).