SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0071
         (637 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1231 + 25047067-25047262,25047876-25048045,25048897-250490...    28   5.4  
11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377...    28   7.1  
04_03_0897 - 20646750-20646918,20647927-20648038,20649650-206501...    28   7.1  
03_02_0870 + 11964135-11964224,11965013-11965175,11965262-119653...    27   9.4  

>07_03_1231 +
           25047067-25047262,25047876-25048045,25048897-25049030,
           25049122-25049369,25049799-25049904,25049992-25050130,
           25050258-25050385,25050472-25050733
          Length = 460

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 14/26 (53%), Positives = 16/26 (61%)
 Frame = +1

Query: 85  LPKLAHLAPSSDLRLHRSSKPEFSPI 162
           L  L +LAP  DLR+  SSKP F  I
Sbjct: 259 LETLVNLAPVLDLRIFSSSKPSFIKI 284


>11_01_0489 +
           3776563-3776692,3776995-3777073,3777532-3777840,
           3778828-3778898,3778975-3779213,3779306-3779383,
           3779734-3780156,3780416-3780661,3780886-3780978,
           3781480-3781527
          Length = 571

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = -2

Query: 345 KSIVGTGYRGERLIEPSSSWFRPKFPSG 262
           + + GTG      + PSS+WF P+  SG
Sbjct: 12  RCVFGTGPLPPASLSPSSAWFDPELSSG 39


>04_03_0897 -
           20646750-20646918,20647927-20648038,20649650-20650108,
           20650237-20650330,20650449-20650525,20650637-20650688,
           20650770-20650927,20651191-20651281,20651465-20652529
          Length = 758

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 12/37 (32%), Positives = 24/37 (64%)
 Frame = -1

Query: 418 DGELCLVRSKSGETLMEDRSDSDVQIDRRNWV*GRKT 308
           DG+  +V + SGE    D+S  ++Q+D+  ++ G+K+
Sbjct: 436 DGKGFIVGTTSGECRFYDQSGENIQLDKELFMQGKKS 472


>03_02_0870 +
           11964135-11964224,11965013-11965175,11965262-11965380,
           11965971-11966083,11966179-11966234,11966320-11966417,
           11966588-11966725,11966820-11967125,11967208-11967471,
           11967587-11967754,11967838-11968056,11968115-11968158,
           11968761-11968830,11968949-11969110,11969672-11969779,
           11969873-11969910,11970121-11970265,11970800-11970926,
           11971037-11971230,11971529-11971659,11972014-11972089,
           11972218-11972328,11972465-11972647,11973264-11973407,
           11973946-11973969,11974555-11974728,11974808-11975155,
           11975232-11975561,11975776-11975961,11976052-11977026,
           11977145-11977399
          Length = 1852

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -1

Query: 169 NFKWVRTPAYSNDEAGDLMTVPSGPILVSRTGA 71
           +F W   P + N++AG   + PS P+  S +G+
Sbjct: 282 SFAWAMIPLFENNQAGGAAS-PSSPLAPSMSGS 313


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,790,696
Number of Sequences: 37544
Number of extensions: 387675
Number of successful extensions: 774
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 758
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 774
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1561213104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).