SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0067
         (605 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_05_0168 + 22875488-22876072                                         29   3.8  
03_05_0617 + 26163161-26163595,26163678-26164202                       29   3.8  
07_03_1005 + 23249040-23249228,23250453-23250574,23250654-232508...    28   6.6  
04_04_0456 - 25355409-25355751,25356047-25356205,25356317-253565...    28   6.6  
06_03_1107 + 27654202-27654421,27656415-27656686,27657565-27657987     27   8.7  
03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340...    27   8.7  

>05_05_0168 + 22875488-22876072
          Length = 194

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 4/54 (7%)
 Frame = +1

Query: 406 AAGAQITHSRHG----SFSGLPGPLGQGEHADSFSVARGGPGHLRASQTCYCSI 555
           AAGA    S HG    +  GLP  L +   + S    +GG G +   Q   CSI
Sbjct: 76  AAGAAAAASMHGLDAEAIGGLPVTLYRPRDSSSPPAGKGGGGGVDDDQAAQCSI 129


>03_05_0617 + 26163161-26163595,26163678-26164202
          Length = 319

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 20/58 (34%), Positives = 22/58 (37%), Gaps = 5/58 (8%)
 Frame = -1

Query: 524 RCPGPPRATLKESACSPWPRGPGNPLKLPCREWVICAP-----AAFLGCGSRFSGSLS 366
           R  G   A   E  C          L LPCR    CAP     AA   CG   +GS+S
Sbjct: 258 RAAGDGEAASAERRCKGCGEAAAVVLLLPCRHLCACAPCAAAAAACPACGCAKNGSVS 315


>07_03_1005 +
           23249040-23249228,23250453-23250574,23250654-23250800,
           23250932-23250998,23251763-23251836,23252010-23252102,
           23253433-23253550,23254340-23254402,23254774-23254806,
           23255325-23255399
          Length = 326

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = -1

Query: 518 PGPPRATLKESACSPWPRGPGNPLKLPCREWV-ICAPAAFLG 396
           P PP + L  SA + +PR P N  +   R+ V +C+ A   G
Sbjct: 31  PPPPASPLLSSASARFPRAPCNAARWSRRDAVRVCSQAGAAG 72


>04_04_0456 -
           25355409-25355751,25356047-25356205,25356317-25356513,
           25356602-25356794,25357044-25358287
          Length = 711

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 19/72 (26%), Positives = 28/72 (38%), Gaps = 5/72 (6%)
 Frame = +1

Query: 322 LPWLSRVTGNQGSIPEREPEKRLPHPRKAAGAQITHSRH-----GSFSGLPGPLGQGEHA 486
           L WLS  + +  ++P R      P P    GA + ++          SGLP P  +    
Sbjct: 117 LSWLSSNSTSAAALPRRSLPPHPPIPPAGGGADLRNTARRTQSGAEGSGLPAPAAEQTAK 176

Query: 487 DSFSVARGGPGH 522
              S  R G G+
Sbjct: 177 PRVSDLRSGAGN 188


>06_03_1107 + 27654202-27654421,27656415-27656686,27657565-27657987
          Length = 304

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 10/17 (58%), Positives = 14/17 (82%), Gaps = 1/17 (5%)
 Frame = -1

Query: 464 GPGNPLKLPCRE-WVIC 417
           G G+P+KLP +E WV+C
Sbjct: 154 GQGDPMKLPLKEDWVLC 170


>03_06_0399 -
           33632811-33633107,33633236-33633385,33633705-33634029,
           33635315-33635982,33636967-33637212,33637405-33637545,
           33637807-33637856,33637943-33638060,33638304-33638910,
           33639339-33639463,33639813-33639869,33639952-33640023,
           33640100-33640232,33640305-33640428,33640522-33640576,
           33640672-33641322
          Length = 1272

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = -2

Query: 406 PSLDVVAVSQAPSPESNPDSPLP 338
           P LD   ++Q PSP +NP  P P
Sbjct: 55  PPLDEETLAQFPSPPTNPSPPPP 77


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,397,910
Number of Sequences: 37544
Number of extensions: 403612
Number of successful extensions: 1185
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1158
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1185
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1442939384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).