SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0038
         (703 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_01_0610 - 7997406-7998047,7998379-7998426,8000719-8001143,800...    31   0.67 
03_05_0543 - 25404630-25405408,25405461-25405605                       29   3.6  
06_03_0099 + 16633928-16638213,16638299-16638386,16638823-166389...    29   4.7  
07_03_1231 + 25047067-25047262,25047876-25048045,25048897-250490...    28   6.2  
01_01_0094 - 730484-731570,732030-732715                               28   6.2  
12_02_1002 + 25176434-25176501,25176613-25176859,25178106-251781...    28   8.3  
05_02_0003 + 5520331-5520476,5520572-5520644,5520762-5520928,552...    28   8.3  

>04_01_0610 -
           7997406-7998047,7998379-7998426,8000719-8001143,
           8002301-8002589
          Length = 467

 Score = 31.5 bits (68), Expect = 0.67
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 2/53 (3%)
 Frame = +1

Query: 10  REQLLFTRNPSPRQSSRASLEYLLLPPRSAP--TEAPSGLTPRPFCALRRARP 162
           +E + F +NP     SR  L  LLLPP   P   +AP    PRP+C     RP
Sbjct: 369 QEVVDFLKNPD----SRRLLLLLLLPPPGPPPLAQAPPRHPPRPWCRPHTPRP 417


>03_05_0543 - 25404630-25405408,25405461-25405605
          Length = 307

 Score = 29.1 bits (62), Expect = 3.6
 Identities = 20/48 (41%), Positives = 24/48 (50%), Gaps = 6/48 (12%)
 Frame = +1

Query: 37  PSPRQSSRASLEYLLLPP---RSAPTEAPSGLTP---RPFCALRRARP 162
           P PR+   A L  +  PP   R AP  AP+ LTP   + F A RR  P
Sbjct: 136 PEPRRPPAAPLPGVRTPPSPPRRAPAPAPAPLTPALSQRFLAERRPAP 183


>06_03_0099 +
           16633928-16638213,16638299-16638386,16638823-16638950,
           16640008-16640278
          Length = 1590

 Score = 28.7 bits (61), Expect = 4.7
 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 3/36 (8%)
 Frame = +3

Query: 246 RHPFQGWLLRQVSRCTLLSGFRL---PWPPSCCHER 344
           R    G+LLR  +   LLS  RL   P PP CCH R
Sbjct: 58  RFMLDGYLLRHSAHFLLLSA-RLRPPPPPPRCCHRR 92


>07_03_1231 +
           25047067-25047262,25047876-25048045,25048897-25049030,
           25049122-25049369,25049799-25049904,25049992-25050130,
           25050258-25050385,25050472-25050733
          Length = 460

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 14/26 (53%), Positives = 16/26 (61%)
 Frame = +1

Query: 427 LPKLAHLAPSSDLRLHRSSKPEFSPI 504
           L  L +LAP  DLR+  SSKP F  I
Sbjct: 259 LETLVNLAPVLDLRIFSSSKPSFIKI 284


>01_01_0094 - 730484-731570,732030-732715
          Length = 590

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = +3

Query: 297 LSGFRLPWPPSCCHERPTPFMVSHERFLGALT 392
           + G +LP  P  C + P P +V   RF   LT
Sbjct: 552 VDGLQLPSRPFFCDDEPLPLLVDSYRFSSELT 583


>12_02_1002 +
           25176434-25176501,25176613-25176859,25178106-25178171,
           25178754-25178822,25179007-25179080,25180850-25180991,
           25181546-25181596,25181769-25181774
          Length = 240

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -1

Query: 109 PPSVQILVVVANTPARPW 56
           PPS  +LV+V   P RPW
Sbjct: 174 PPSSALLVIVEEGPTRPW 191


>05_02_0003 +
           5520331-5520476,5520572-5520644,5520762-5520928,
           5520929-5521223,5521531-5521674,5521756-5521890,
           5522004-5522093,5523702-5523809,5523905-5523986,
           5525362-5525417,5525888-5525986,5526090-5526394,
           5526898-5527075,5527167-5527280,5527376-5527507,
           5527614-5527718
          Length = 742

 Score = 27.9 bits (59), Expect = 8.3
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = -1

Query: 424 RTGAVG*TKRSVKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRLTCRSNQP 260
           +TG  G  KR +KA +K S+D +    R  QQ G + + +   ++Q+   +S  P
Sbjct: 267 KTGDFG--KRPIKAMEKLSYDAICSGARCIQQQGNNSNMSRSDALQQYHSKSFNP 319


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,484,757
Number of Sequences: 37544
Number of extensions: 507872
Number of successful extensions: 1583
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1522
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1582
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1803843684
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).