SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0032
         (636 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_01_0584 + 4345134-4345237,4346165-4346267,4346397-4346466,434...    53   2e-07
03_06_0300 + 32967935-32968029,32968975-32969077,32969175-329692...    52   3e-07
05_07_0116 - 27785083-27786123,27786201-27786278,27786364-277869...    48   5e-06
07_01_1123 - 10385215-10385574,10385676-10385810,10386385-103870...    30   1.3  
01_06_0293 - 28254673-28254878,28255189-28255306,28255767-282559...    30   1.3  
11_08_0034 - 27827583-27827998,27828111-27829430,27829568-27831008     29   2.3  
11_08_0032 - 27807489-27807497,27807641-27807684,27808046-278081...    29   2.3  
08_02_0092 + 12265446-12265809,12266147-12266743,12266792-122668...    28   5.4  
12_01_1079 - 11223247-11223336,11223606-11223717,11224743-112248...    28   7.1  
06_01_0318 - 2284481-2284594,2285340-2286044,2286589-2286609,228...    28   7.1  
02_05_0074 - 25608689-25609138                                         28   7.1  
12_02_0412 - 18799217-18801061                                         27   9.4  
05_01_0068 + 475647-476006                                             27   9.4  
01_06_0944 + 33211652-33212427,33212492-33212660,33212825-332129...    27   9.4  
01_01_0363 + 2850954-2853675,2853819-2854225                           27   9.4  

>07_01_0584 +
           4345134-4345237,4346165-4346267,4346397-4346466,
           4346552-4346590,4346684-4346801,4346894-4346951,
           4347031-4347095,4347281-4347341,4347678-4347779,
           4348005-4348070,4348399-4348443,4348540-4348797,
           4349289-4349501,4350103-4350411,4350461-4350613
          Length = 587

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 33/85 (38%), Positives = 52/85 (61%), Gaps = 2/85 (2%)
 Frame = -1

Query: 504 QGFSWRGGSERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDS--ESTVRDCATVFA 331
           +GF      +  T GI +W    +  ++ G KV+++ LDT+G F+S  +S V D   +FA
Sbjct: 92  KGFGVGHMRDTKTKGIWVWGTPIELDVN-GSKVSVLYLDTEG-FESIGKSNVYD-DRIFA 148

Query: 330 LSTMLSSVQIYNLSQNIQEDDLQHL 256
           L+T+LSS+ IYNL + I+E D+  L
Sbjct: 149 LATVLSSILIYNLPETIREADISRL 173


>03_06_0300 +
           32967935-32968029,32968975-32969077,32969175-32969244,
           32969464-32969581,32969687-32969744,32969831-32969895,
           32969990-32969996,32970087-32970147,32970757-32970776,
           32970858-32970923,32971126-32971293,32971372-32971629,
           32972098-32972310,32972824-32973099
          Length = 525

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 31/71 (43%), Positives = 47/71 (66%), Gaps = 2/71 (2%)
 Frame = -1

Query: 462 GILMWSEIFKATLDDGEKVAIILLDTQGAFDS--ESTVRDCATVFALSTMLSSVQIYNLS 289
           GI +W    +  +D G KV+++ LDT+G F+S  +S V D   +FAL+T+LSSV IYNL 
Sbjct: 90  GIWIWGTPVEMDID-GSKVSVLYLDTEG-FESVGKSNVYD-DRIFALATVLSSVLIYNLP 146

Query: 288 QNIQEDDLQHL 256
           + ++E D+  L
Sbjct: 147 ETVREADISRL 157


>05_07_0116 -
           27785083-27786123,27786201-27786278,27786364-27786976,
           27787128-27787213,27787316-27787438,27787600-27787734,
           27787930-27788019,27788796-27788981,27789560-27789661,
           27789787-27789900,27790010-27790153,27790260-27790325,
           27790895-27791056,27791668-27791916
          Length = 1062

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = -1

Query: 468 TTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLS 289
           T G+ MWS   K T  DG +  ++LLDT+G    + T      +F+L+ +LSS+ IYN  
Sbjct: 101 TKGLWMWSAPLKRTGLDGTEYNLVLLDTEGIDAYDQTGTYSIQIFSLAVLLSSMFIYNQM 160

Query: 288 QNIQEDDLQHLH-CSQSTVGWRSRTGAG 208
             I E  L  L   ++ T   R R   G
Sbjct: 161 GGIDEAALDRLSLVTEMTKHIRVRASGG 188


>07_01_1123 -
           10385215-10385574,10385676-10385810,10386385-10387091,
           10387158-10387455
          Length = 499

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/39 (41%), Positives = 20/39 (51%)
 Frame = -2

Query: 245 RVRSAGARGRGPDSLPAAAVPRARLELPLRSALRSGRRH 129
           R R  GA  +G D +P  A P  +  LPL +  R GR H
Sbjct: 23  RKRGRGAT-KGDDPVPDEAAPPCKPSLPLATGSRRGRSH 60


>01_06_0293 - 28254673-28254878,28255189-28255306,28255767-28255961,
            28256701-28256800,28256887-28256972,28257078-28257239,
            28257965-28258101,28258233-28258281,28258688-28258746,
            28258862-28258896,28259384-28259433,28260173-28260332,
            28260898-28260963,28261065-28261162,28261649-28261696,
            28262114-28262242,28262667-28262769,28262858-28262954,
            28263181-28263241,28263659-28263740,28263845-28263962,
            28264039-28266325
          Length = 1481

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 14/40 (35%), Positives = 25/40 (62%)
 Frame = -3

Query: 139  DGGMQILSRRLKVSDKQHPELQSLRKHITACFSELACFLM 20
            DG +QI SR++K S  + P+L  + K +  C  E++ F++
Sbjct: 1043 DGSVQIFSRQMKESTSRFPDLVGMIKEL--CSIEVSSFIL 1080


>11_08_0034 - 27827583-27827998,27828111-27829430,27829568-27831008
          Length = 1058

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 19/67 (28%), Positives = 34/67 (50%)
 Frame = -1

Query: 480 SERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQI 301
           +E +  G+  + ++FK  LDDG  VAI +L+ Q      S   +C  V  ++   + ++I
Sbjct: 750 NEDNLLGVGSFGKVFKGRLDDGLVVAIKILNMQVERAIRSFDAEC-HVLRMARHRNLIKI 808

Query: 300 YNLSQNI 280
            N   N+
Sbjct: 809 LNTCSNL 815


>11_08_0032 -
           27807489-27807497,27807641-27807684,27808046-27808168,
           27810770-27810983,27811382-27811530,27811719-27812618,
           27812964-27814659
          Length = 1044

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 19/67 (28%), Positives = 34/67 (50%)
 Frame = -1

Query: 480 SERDTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRDCATVFALSTMLSSVQI 301
           +E +  G+  + ++FK  LDDG  VAI +L+ Q      S   +C  V  ++   + ++I
Sbjct: 695 NEDNLLGVGSFGKVFKGRLDDGLVVAIKILNMQVERAIRSFDAEC-HVLRMARHRNLIKI 753

Query: 300 YNLSQNI 280
            N   N+
Sbjct: 754 LNTCSNL 760


>08_02_0092 +
           12265446-12265809,12266147-12266743,12266792-12266861,
           12267325-12267427
          Length = 377

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 9/32 (28%), Positives = 14/32 (43%)
 Frame = +3

Query: 279 GCFARGCISERTTASWTERTRSRSLAPWIHCR 374
           G     CI + +   W+ +  S   A W+ CR
Sbjct: 221 GSLGFACIEDSSLYVWSRKVNSEGAAEWVQCR 252


>12_01_1079 -
           11223247-11223336,11223606-11223717,11224743-11224825,
           11226061-11226173,11226261-11226337,11228626-11228719,
           11229072-11229160,11230485-11230560,11231637-11231808
          Length = 301

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 2/49 (4%)
 Frame = +2

Query: 5   ESRVRHEEAGQLRE-ARRYVLAEGLQLWMLFV*YL*SS*QYLH-AAVRS 145
           E  V  EE G   E A++Y ++ GL  W L   Y  +  +Y H  +VRS
Sbjct: 235 EYEVLDEEPGDDEESAQKYEISPGLSFWFLVCFYYNNQIRYCHDTSVRS 283


>06_01_0318 -
           2284481-2284594,2285340-2286044,2286589-2286609,
           2287186-2287257,2287762-2287842,2288059-2288133,
           2288197-2288484
          Length = 451

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 26/75 (34%), Positives = 30/75 (40%), Gaps = 3/75 (4%)
 Frame = -3

Query: 469 HDRHTHVVRDIQSDAR*W*KGSDNIARHARRLRQ*I---HGARLRDRVRSVHDAVVRSDI 299
           HDRH    RD   D R     S N+ R  R  R      HG     R RS      R++ 
Sbjct: 310 HDRHAREDRD--RDYRRSSYSSRNVDRQGRERRDRDSDRHGRSSARRSRSRSPNRGRTEG 367

Query: 298 QPLAKHPGGRPPAPS 254
           +     P GRPP PS
Sbjct: 368 ENHRSSPFGRPPEPS 382


>02_05_0074 - 25608689-25609138
          Length = 149

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 18/48 (37%), Positives = 23/48 (47%)
 Frame = -2

Query: 206 SLPAAAVPRARLELPLRSALRSGRRHADTVKKIKGIRQTASRAAVPPQ 63
           S  AAA  R    LP R+ LR+ R  A T + +      A  AAV P+
Sbjct: 22  SAAAAAAARCLGPLPRRARLRTARHVALTPRDLSAEDVAAEEAAVAPK 69


>12_02_0412 - 18799217-18801061
          Length = 614

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 9/29 (31%), Positives = 21/29 (72%)
 Frame = -3

Query: 118 SRRLKVSDKQHPELQSLRKHITACFSELA 32
           ++ +K + ++HP LQ +R+ +  C+S+L+
Sbjct: 67  NKSIKKALEKHPTLQGMRRILRICYSDLS 95


>05_01_0068 + 475647-476006
          Length = 119

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 16/58 (27%), Positives = 26/58 (44%)
 Frame = -1

Query: 396 LLDTQGAFDSESTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLHCSQSTVGWRS 223
           LL  +  +   +   D A+   LS +L + Q  +L        L H H + +T GWR+
Sbjct: 58  LLSHRPKWGGAANKEDAASCSGLSFLLPTHQPRSLPPAASSTPLPHHHPAGATAGWRN 115


>01_06_0944 +
           33211652-33212427,33212492-33212660,33212825-33212936,
           33213061-33213159,33213237-33213394,33214911-33215062,
           33215162-33215249,33215399-33215476,33215516-33215690,
           33216701-33217002
          Length = 702

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = -1

Query: 471 DTTGILMWSEIFKATLDDGEKVAIILLDTQGAFDSESTVRD 349
           DT+GILM+       + DG   +  +    GA D+E+T+ D
Sbjct: 97  DTSGILMFDTSGNLVILDGRGSSFTVAYGSGAKDTEATILD 137


>01_01_0363 + 2850954-2853675,2853819-2854225
          Length = 1042

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 1/46 (2%)
 Frame = -1

Query: 480 SERDTTGILMWSEIFKATL-DDGEKVAIILLDTQGAFDSESTVRDC 346
           SE +  G   +  ++K TL D+GE VAI + D +    S S   +C
Sbjct: 722 SEANLLGKGRYGSVYKCTLQDEGEPVAIKVFDLKQLGSSRSFQAEC 767


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,776,566
Number of Sequences: 37544
Number of extensions: 374500
Number of successful extensions: 1431
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1371
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1429
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1561213104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).