SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0021
         (673 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_02_0328 - 7487759-7488340                                           30   1.5  
02_05_0110 + 25914110-25915006,25915726-25915797,25916411-259166...    30   1.9  
06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,890...    29   2.6  
03_05_1065 + 30061588-30061883,30061995-30062056,30062196-300622...    29   3.4  
01_01_0613 - 4571689-4572348                                           29   3.4  
06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764           29   4.5  
12_02_0046 + 12830974-12832386                                         28   7.8  
02_05_0125 + 26046448-26046654,26046754-26047149,26047557-26047763     28   7.8  

>03_02_0328 - 7487759-7488340
          Length = 193

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 26/90 (28%), Positives = 36/90 (40%), Gaps = 6/90 (6%)
 Frame = -2

Query: 648 IWIKPALPFAPREVSVLSELALGHLRYSLTDVPPQSNSPP--GSVLEPDTREF*TATSVS 475
           ++  P+LP  P     L  L     +Y+    PP    PP  G    P TR+       S
Sbjct: 27  LYSSPSLPLLPSNQPPLLPLPPAATKYATFPYPPPPQQPPRSGRASTPSTRQRDRRRKPS 86

Query: 474 ATSPLCTL---GTKHRAPADIIDRA-PLPP 397
              P       GT+ + P   ++RA PLPP
Sbjct: 87  RPPPSTETTKGGTQKKKP---LERATPLPP 113


>02_05_0110 +
           25914110-25915006,25915726-25915797,25916411-25916699,
           25916864-25916949,25917267-25917490,25917674-25917740,
           25917830-25917889,25917995-25918078,25918475-25918555
          Length = 619

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
 Frame = -2

Query: 162 LDDEAFGYL-KRVIVTPAVYPRLLEFLHVDIQSTG 61
           LDDE   YL  R  V   +  RLL+F++VD  STG
Sbjct: 279 LDDEDISYLTNRAAVYIEMGKRLLKFIYVDPSSTG 313


>06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,
            8905437-8905690,8905785-8908799,8908889-8909001,
            8909975-8910164,8910399-8910512,8910591-8910698,
            8910941-8911073,8911206-8911408,8911626-8911826
          Length = 1889

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +3

Query: 138  GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRE 239
            G+  PR +  D  EW N  PT+   ++ + +PRE
Sbjct: 1393 GNCAPRTVECDEGEWYNNFPTIDENHVQRNKPRE 1426


>03_05_1065 +
           30061588-30061883,30061995-30062056,30062196-30062276,
           30062391-30062464,30062547-30062629,30063044-30063147,
           30063526-30063665,30063736-30063783,30063939-30063991,
           30064178-30064262,30064346-30064412,30064496-30064606,
           30065262-30065283,30066244-30071110,30071186-30071374,
           30071463-30071577,30072329-30073388,30074247-30074694,
           30074966-30075019,30075105-30076898,30076989-30077949,
           30078271-30078384,30078459-30078613,30078934-30079026,
           30079341-30079613,30093423-30093975,30094465-30094540,
           30094619-30094718
          Length = 4025

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 18/63 (28%), Positives = 28/63 (44%)
 Frame = -2

Query: 600 LSELALGHLRYSLTDVPPQSNSPPGSVLEPDTREF*TATSVSATSPLCTLGTKHRAPADI 421
           L+  + GH R+ + D   +  S  G   + D        +VSA + LC +   H AP  +
Sbjct: 378 LATTSSGHRRFGMEDEIEEELSLAGIFNKGDRSYAVRRAAVSAYAALCAVLCAHEAPGGL 437

Query: 420 IDR 412
            DR
Sbjct: 438 PDR 440


>01_01_0613 - 4571689-4572348
          Length = 219

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 18/59 (30%), Positives = 30/59 (50%)
 Frame = -2

Query: 591 LALGHLRYSLTDVPPQSNSPPGSVLEPDTREF*TATSVSATSPLCTLGTKHRAPADIID 415
           L LGH  YSL   PP S   P  V   +  ++  ++S SA +    +G + R+  +++D
Sbjct: 51  LELGHSVYSLPLPPPPSQ--PVVVAGGNNDQYGVSSSSSAAATTSRIGFRTRSEVEVLD 107


>06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764
          Length = 640

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = -1

Query: 466 TTLHAWNETPCARRYY 419
           TT  AW ETPCA R++
Sbjct: 560 TTTEAWVETPCAHRFH 575


>12_02_0046 + 12830974-12832386
          Length = 470

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 25/83 (30%), Positives = 34/83 (40%), Gaps = 3/83 (3%)
 Frame = -2

Query: 636 PALPFAPREVSVLSELALGHLRYSLTDVP--PQSNSPPGSV-LEPDTREF*TATSVSATS 466
           PA    PR+V V+++     L+     VP  P +    G V   P  R+  +  + SA  
Sbjct: 254 PAAVAPPRQVPVITQQQAPPLKRPAPPVPSPPCAKKIRGPVSASPAARQ--SCVAASAPP 311

Query: 465 PLCTLGTKHRAPADIIDRAPLPP 397
           P C       AP      APLPP
Sbjct: 312 PWCVPPPPRPAPPSRRVMAPLPP 334


>02_05_0125 + 26046448-26046654,26046754-26047149,26047557-26047763
          Length = 269

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 12/37 (32%), Positives = 17/37 (45%)
 Frame = -1

Query: 556 CTAPVKLPAWQCPRTGHAGVLNGDERFRHVTTLHAWN 446
           C+A   +PA   P T H G         ++TTL  W+
Sbjct: 134 CSADDAVPAPAAPATSHGGSSGSSSISEYLTTLPGWH 170


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,513,588
Number of Sequences: 37544
Number of extensions: 468136
Number of successful extensions: 1449
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1407
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1449
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1703141568
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).