SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVf0002
         (720 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_05_0005 - 16886553-16886946,16887079-16887404                       31   0.92 
05_05_0322 + 24094831-24094992,24095147-24095216,24096184-240963...    29   3.7  

>01_05_0005 - 16886553-16886946,16887079-16887404
          Length = 239

 Score = 31.1 bits (67), Expect = 0.92
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 3/47 (6%)
 Frame = -1

Query: 306 RYVRKRVSITA---DAVHRQPAHKCNYELFNRNNFSIRYWSWNYRGC 175
           ++VR   ++TA   D     P  +C      R+N S RYW W   GC
Sbjct: 61  KWVRDAAAVTAYREDCPFLDPGFQCISN--GRSNSSFRYWRWQPHGC 105


>05_05_0322 +
           24094831-24094992,24095147-24095216,24096184-24096307,
           24096403-24096502,24096598-24096825,24096916-24097041,
           24097092-24097376,24097490-24097648,24097751-24097929,
           24098078-24098210
          Length = 521

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = -2

Query: 326 LERRLTDDMSANVSVSPRMR 267
           LERR TD MS+ V V+P+MR
Sbjct: 283 LERRPTDYMSSQVEVNPKMR 302


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,018,203
Number of Sequences: 37544
Number of extensions: 380649
Number of successful extensions: 834
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 823
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 834
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1874582652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).