BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e96h0117 (691 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1015 + 23307700-23307906,23309274-23309483,23309915-233100... 138 4e-33 04_04_1339 + 32760424-32760584,32762428-32764462 33 0.28 06_01_0041 + 403634-403817,404154-404332,404431-404536,404620-40... 31 1.1 >07_03_1015 + 23307700-23307906,23309274-23309483,23309915-23310085, 23310163-23310286,23310753-23310814,23311185-23311266, 23311870-23312009 Length = 331 Score = 138 bits (334), Expect = 4e-33 Identities = 64/113 (56%), Positives = 78/113 (69%) Frame = +2 Query: 218 CSGFHWKAGYLPRQQALDYGTKVVGGVSPKKAGTEHLGKPVFGTVKEAKAGTGATASVIY 397 C G K G +QA++YGT +VGGV+PKK GTEHLG PVF +V EAKA T A ASVIY Sbjct: 47 CQGITGKNGTFHTEQAIEYGTTMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIY 106 Query: 398 VPPPGXXXXXXXXXXXXMPLIVCITEGVPQHDMVRVKMPFLRQNKSRLVGPNC 556 VPPP + L+VCITEG+PQHDMV+VK +Q+K+RL+GPNC Sbjct: 107 VPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNKQSKTRLIGPNC 159 Score = 31.9 bits (69), Expect = 0.49 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 189 LILTSETKVIVQGFTGKQGTFHANKPL 269 + + T+VI QG TGK GTFH + + Sbjct: 37 VFVDKSTRVICQGITGKNGTFHTEQAI 63 >04_04_1339 + 32760424-32760584,32762428-32764462 Length = 731 Score = 32.7 bits (71), Expect = 0.28 Identities = 18/47 (38%), Positives = 26/47 (55%) Frame = +3 Query: 51 FPFRRFTFNNSTMAMPVRVLSKFKDGLKLGNVRFASGNPYAETRKNL 191 F RR N ST M V +L DGL G++ A+G P+A+ ++ L Sbjct: 550 FGGRRHELNVSTYQMCVLMLFNSADGLTYGDIEQATGIPHADLKRCL 596 >06_01_0041 + 403634-403817,404154-404332,404431-404536,404620-404936, 405231-405605,406199-406283,406570-408066,408575-408738 Length = 968 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 242 GYLPRQQALDYGTKVVGGVSPKKAGT 319 GY P +Q L +GT + GV+PK++GT Sbjct: 656 GYYPGEQVLPFGT-IKDGVAPKESGT 680 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,935,365 Number of Sequences: 37544 Number of extensions: 402504 Number of successful extensions: 1075 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1074 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1756684372 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -