SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0040
         (740 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0092 + 673271-673452,673546-673621,674043-674104,674504-67...    29   2.9  
07_03_0505 + 18858406-18858522,18859860-18859955,18860760-18861047     28   6.8  
12_01_0029 + 248725-248769,248870-249074,250040-250128,250237-25...    28   9.0  
11_01_0030 + 233285-233329,233439-233643,234637-234725,234834-23...    28   9.0  

>08_01_0092 +
           673271-673452,673546-673621,674043-674104,674504-674606,
           674811-674852,674962-675123
          Length = 208

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -3

Query: 621 R*IYGER*NHHVTLSVFNKAAYYLEHFIFN 532
           R IYG R N H+T+   N    YLE +++N
Sbjct: 107 RYIYGNRANEHMTVEELNALERYLEIWMYN 136


>07_03_0505 + 18858406-18858522,18859860-18859955,18860760-18861047
          Length = 166

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 3/57 (5%)
 Frame = -1

Query: 596 ITTSRFPCSIRRHII*NISFSTQM--ISPASNEIIDHVSVTNMHLLIKIEV-SKETF 435
           +T S  P  + RH    +  S +   I+P  NE +  +S+TNM L +KIEV  K+TF
Sbjct: 24  LTHSSDPYVVLRHGSQKVKSSIRYHSINPEWNEELT-LSITNMMLPVKIEVFDKDTF 79


>12_01_0029 +
           248725-248769,248870-249074,250040-250128,250237-250315,
           250429-250556,250764-250862,250953-251061,251301-251380,
           251464-251691,251768-251833,251970-252086,252538-252735,
           252847-252963,253056-253115,253228-253314,253419-253502,
           253623-253757,253837-253899,253979-254083,254174-254286,
           254374-254626,254715-254851,254970-255248,255352-256354,
           256450-256935,257023-257193,257285-257470,257820-257942,
           258024-258134,258225-258395
          Length = 1708

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%)
 Frame = -1

Query: 320 NRNKKRL--NLLSHWDIETKEELGDFSQTQSFEL*LTLIERGR 198
           N+NKK L  N L+   +E  EELGD  +T   +L L +  + R
Sbjct: 454 NQNKKNLLENWLAEDKLECSEELGDLVKTVDNDLALKIYIKAR 496


>11_01_0030 +
           233285-233329,233439-233643,234637-234725,234834-234912,
           235048-235175,235383-235481,235572-235680,235920-235999,
           236083-236310,236387-236452,236589-236705,237142-237339,
           237451-237567,237660-237719,237832-237918,238023-238106,
           238233-238367,238446-238508,238588-238692,238781-238893,
           238981-239233,239322-239458,239577-239855,239958-240960,
           241054-241539,241627-241797,241890-242075,242426-242548,
           242630-242740,242834-243004
          Length = 1708

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%)
 Frame = -1

Query: 320 NRNKKRL--NLLSHWDIETKEELGDFSQTQSFEL*LTLIERGR 198
           N+NKK L  N L+   +E  EELGD  +T   +L L +  + R
Sbjct: 454 NQNKKNLLENWLAEDKLECSEELGDLVKTVDNDLALKIYIKAR 496


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,657,600
Number of Sequences: 37544
Number of extensions: 297588
Number of successful extensions: 434
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 429
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 434
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1957111448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).