SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0039
         (826 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_02_0555 - 10588685-10592038                                         78   1e-14
10_07_0032 + 12096290-12097042,12097056-12098066,12110194-12110454     77   1e-14
03_02_1029 - 13488535-13493037                                         77   1e-14
06_03_0557 + 22133604-22134506                                         76   3e-14
08_02_0167 - 13564466-13566227,13566361-13566644,13566684-135675...    76   4e-14
10_04_0010 - 7487455-7489490,7489569-7489980                           75   5e-14
08_02_0235 + 14627648-14628889                                         75   7e-14
05_03_0216 + 10370531-10371922,10378656-10378808                       75   7e-14
11_01_0792 + 6679002-6679603,6738490-6738520,6738532-6739644           75   9e-14
07_01_1086 - 9930311-9931993                                           75   9e-14
04_01_0187 - 2153546-2154520,2154581-2155858                           75   9e-14
08_01_0749 + 7063297-7064370                                           74   2e-13
02_01_0344 + 2467191-2468282                                           73   2e-13
07_01_1133 - 10550799-10551137,10552195-10552254,10555693-105574...    73   3e-13
07_01_1081 + 9831606-9832499                                           73   3e-13
11_04_0054 - 12895574-12895840,12906985-12908121,12908274-12908591     72   6e-13
10_01_0300 - 3257584-3258825                                           71   9e-13
04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902,420...    71   9e-13
03_05_0310 + 23008915-23009841,23010401-23011162                       70   2e-12
08_02_0360 + 16196712-16197560,16198126-16198875                       68   1e-11
11_04_0146 - 14091671-14092357,14092996-14093229                       66   4e-11
06_02_0306 + 14115751-14116450,14116882-14117691,14118957-14119141     66   4e-11
04_02_0034 - 8999618-9000358,9001439-9001618,9001666-9003621,900...    65   6e-11
02_02_0554 - 11434744-11435364,11435741-11436442                       64   1e-10
01_05_0044 + 17531005-17531739,17532624-17532956,17532968-17533027     64   1e-10
08_02_0118 + 12772636-12772910,12773151-12773254,12774097-127744...    64   2e-10
11_04_0032 + 12545208-12545954                                         63   2e-10
03_05_0186 + 21731294-21732277                                         63   2e-10
04_03_0027 + 9667508-9668800                                           63   3e-10
04_03_0736 - 19145428-19145474,19145608-19145721,19146707-191478...    59   5e-09
08_02_0206 + 14286721-14287239,14291236-14291466,14291557-14292030     58   8e-09
04_04_1405 - 33305948-33309676,33309749-33310468,33310533-333114...    58   1e-08
11_04_0046 + 12751830-12752285,12752385-12752670,12753329-12753786     57   2e-08
02_05_0739 + 31401372-31402371,31402667-31402719                       56   3e-08
09_06_0375 - 22653366-22657112,22657185-22658457,22658833-22659539     56   3e-08
07_03_0135 + 14070212-14070311,14072207-14072968,14082526-140826...    56   3e-08
07_03_0014 - 12428713-12428860,12429340-12429580,12429664-124303...    55   8e-08
10_02_0198 - 6611775-6612611                                           54   1e-07
11_04_0010 - 12139533-12139571,12140893-12141230,12141235-12141721     54   2e-07
02_02_0042 - 6297211-6297981                                           54   2e-07
12_02_0003 + 12149032-12149562,12149662-12149732,12150160-12150421     53   3e-07
07_01_0602 + 4485753-4486751                                           53   3e-07
12_01_1102 + 11622839-11623341,11623441-11623750                       52   7e-07
04_01_0251 - 3294223-3294272,3295189-3295264,3295789-3296052,329...    51   1e-06
07_03_1435 - 26532302-26533159,26533559-26534902,26535180-26535188     51   1e-06
06_02_0323 + 14381803-14382091,14382116-14382348,14382364-143824...    51   1e-06
12_02_0637 - 21437244-21438080                                         50   2e-06
06_03_0300 + 19299378-19299688,19299839-19300268                       50   2e-06
10_05_0102 - 9176459-9176767,9176793-9176858                           50   3e-06
10_07_0030 - 12044953-12045524,12045567-12045876                       49   5e-06
07_02_0014 + 11799589-11799788,11799813-11800074                       49   5e-06
05_03_0427 - 13886814-13887935                                         49   5e-06
05_03_0260 - 11200887-11200907,11200979-11201961,11212201-11212390     45   6e-05
12_02_0210 - 15617770-15618453                                         45   8e-05
01_05_0591 + 23481400-23481479,23481518-23482538,23482574-23482996     45   8e-05
01_05_0015 - 17164024-17164193,17164308-17164713                       44   1e-04
09_01_0107 - 1683618-1684028                                           42   6e-04
04_01_0591 + 7806693-7807091                                           41   0.001
01_05_0111 - 18230195-18230239,18230541-18230615,18231379-182315...    41   0.001
08_02_0107 + 12494650-12495270,12507463-12508146,12508325-125084...    40   0.002
12_01_0516 - 4088717-4089181                                           38   0.010
04_01_0293 + 3881375-3883698,3906619-3907636,3907820-3908309,391...    37   0.022
10_05_0084 + 8956637-8956681,8957722-8957856,8958040-8958834           36   0.030
05_03_0317 - 12249228-12249275,12263876-12264518,12264954-122666...    36   0.030
01_05_0320 - 20874691-20875230,20879337-20879590,20880014-208810...    36   0.030
12_01_1034 - 10638984-10639376,10639905-10640093                       36   0.039
07_01_1097 - 10068431-10068655,10068797-10068880,10068945-100692...    36   0.052
08_01_0732 - 6672839-6672937,6672990-6673571,6673755-6674417           35   0.068
03_05_0179 - 21583234-21584336,21586274-21586358,21586665-215867...    35   0.090
01_04_0007 - 15038268-15039062,15039177-15039711,15039887-150399...    35   0.090
12_01_0737 - 6588612-6588922,6595261-6596602,6596639-6596749           34   0.16 
01_01_0914 - 7208910-7209449,7209488-7209919                           33   0.21 
07_01_1177 + 11125945-11126242,11126465-11128303,11128342-11128358     33   0.28 
01_05_0003 - 16841745-16841912,16842005-16842259,16842938-168430...    33   0.36 
12_02_0973 + 24959440-24959451,24959962-24962195,24962539-249626...    29   3.4  
02_03_0058 + 14536336-14536593,14536715-14536984                       29   4.5  
09_04_0394 - 17261008-17262476,17262554-17262743                       29   5.9  
08_01_0083 - 604175-605776                                             29   5.9  
08_01_0082 - 588269-588434,590800-591653                               29   5.9  
06_03_0310 - 19453047-19453160,19453240-19453338,19453441-194535...    29   5.9  
02_03_0388 + 18429538-18430598,18430971-18431081,18431165-184312...    29   5.9  
11_03_0201 + 11578163-11578915                                         28   7.8  
06_03_0372 - 20013078-20013533,20013969-20014062,20014247-20014422     28   7.8  
04_04_0964 - 29749624-29749649,29749742-29749945,29750036-297506...    28   7.8  
01_05_0339 + 21135250-21135467,21136465-21137513,21137905-21138962     28   7.8  

>09_02_0555 - 10588685-10592038
          Length = 1117

 Score = 77.8 bits (183), Expect = 1e-14
 Identities = 36/101 (35%), Positives = 61/101 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 815  GVPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLYQILEDMLRACVL 874

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 875  DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 915


>10_07_0032 + 12096290-12097042,12097056-12098066,12110194-12110454
          Length = 674

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 36/101 (35%), Positives = 61/101 (60%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 396 GVPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVL 455

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 456 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 496


>03_02_1029 - 13488535-13493037
          Length = 1500

 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 36/101 (35%), Positives = 61/101 (60%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 1198 GVPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVL 1257

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 1258 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 1298


>06_03_0557 + 22133604-22134506
          Length = 300

 Score = 76.2 bits (179), Expect = 3e-14
 Identities = 38/101 (37%), Positives = 57/101 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G PK I++D+G  F+S   KQL    G    F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 9   GCPKKIVSDRGTQFTSRFWKQLHEALGTDLNFSTAYHPQTNGQTERVNQILEDMLRACAL 68

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           + + TWD  L  A  +YN++  ++   SP E +FG K   P
Sbjct: 69  DFEGTWDRCLPYAEFSYNNSYQASIQMSPNEAMFGRKCRTP 109


>08_02_0167 - 13564466-13566227,13566361-13566644,13566684-13567540,
            13567684-13567957,13567973-13568218
          Length = 1140

 Score = 75.8 bits (178), Expect = 4e-14
 Identities = 35/101 (34%), Positives = 60/101 (59%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
            G+PK I++D+G+ F+S   K+L+   G +  F++ YHPQ  G  ER +  L++ LR+ ++
Sbjct: 865  GVPKKIVSDRGSQFTSHFWKKLQEELGTRLNFSTTYHPQADGQTERLNQVLEDMLRACVL 924

Query: 643  ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            +   TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 925  DFGKTWDKSLPYAEFSYNNSYRASIQMAPYEALYGRKCRTP 965


>10_04_0010 - 7487455-7489490,7489569-7489980
          Length = 815

 Score = 75.4 bits (177), Expect = 5e-14
 Identities = 35/101 (34%), Positives = 60/101 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  I++D+G+ F+S   K+L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 558 GVPNKIVSDRGSQFTSHFWKKLQEELGTRLNFSTAYHPQTDGQTERLNQILEDMLRACVL 617

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   TWD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 618 DFGKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCRTP 658


>08_02_0235 + 14627648-14628889
          Length = 413

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I+ D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 111 GVPKKIVFDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACVL 170

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 171 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 211


>05_03_0216 + 10370531-10371922,10378656-10378808
          Length = 514

 Score = 74.9 bits (176), Expect = 7e-14
 Identities = 37/101 (36%), Positives = 60/101 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIPK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 244 GIPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 303

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 304 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 344


>11_01_0792 + 6679002-6679603,6738490-6738520,6738532-6739644
          Length = 581

 Score = 74.5 bits (175), Expect = 9e-14
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 279 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 338

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 339 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 379


>07_01_1086 - 9930311-9931993
          Length = 560

 Score = 74.5 bits (175), Expect = 9e-14
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 258 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 317

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 318 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 358


>04_01_0187 - 2153546-2154520,2154581-2155858
          Length = 750

 Score = 74.5 bits (175), Expect = 9e-14
 Identities = 36/101 (35%), Positives = 60/101 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT G  ER +  L++ LR+  +
Sbjct: 494 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDGQTERVNQILEDMLRACAL 553

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 554 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 594


>08_01_0749 + 7063297-7064370
          Length = 357

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/101 (33%), Positives = 62/101 (61%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S+  ++L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 55  GVPKKIVSDRGSQFTSKFWQKLQLEMGTRLNFSTAYHPQTDGQTERVNQVLEDMLRACVL 114

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 115 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 155


>02_01_0344 + 2467191-2468282
          Length = 363

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 36/105 (34%), Positives = 59/105 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP+I+ T QGA+F S+ +K     +G K + +SPY+ Q  G  E S+ TL + ++  I 
Sbjct: 128 GIPQILTTGQGASFMSKEVKSFAESYGNKLLSSSPYYTQANGQAELSNKTLLKIVKKKIE 187

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           E+   W   L  A+ AY  + H  T  +P EL++G +  +P  ++
Sbjct: 188 EHPKRWHEVLSEALWAYRISKHGATKVTPFELVYGQEAVLPVEVN 232


>07_01_1133 -
           10550799-10551137,10552195-10552254,10555693-10557401,
           10557534-10557616,10577533-10578074
          Length = 910

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 34/101 (33%), Positives = 61/101 (60%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S+  ++L+   G    F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 530 GVPKKIVSDRGSQFTSKFWQKLQEEMGTHLNFSTAYHPQTDGQTERVNQILEDMLRACVL 589

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 590 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 630


>07_01_1081 + 9831606-9832499
          Length = 297

 Score = 72.9 bits (171), Expect = 3e-13
 Identities = 34/101 (33%), Positives = 62/101 (61%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S+  ++L+   G +  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 163 GVPKKIVSDRGSQFTSKFWQKLQVEMGTRLNFSTAYHPQTNGQTERVNQILEDMLRACVL 222

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 223 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 263


>11_04_0054 - 12895574-12895840,12906985-12908121,12908274-12908591
          Length = 573

 Score = 71.7 bits (168), Expect = 6e-13
 Identities = 33/101 (32%), Positives = 60/101 (59%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S+  ++L+   G +  F++ YHPQT G  ER +  L++ LR   +
Sbjct: 321 GVPKKIVSDRGSQFTSKFWQKLQEELGTRLNFSTAYHPQTDGQTERVNQILEDILRLCAL 380

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +    WD  L  A  +YN++  ++   +P E L+G++   P
Sbjct: 381 DFGGAWDKSLPYAEFSYNNSYQASLQMAPFEALYGWRCRTP 421


>10_01_0300 - 3257584-3258825
          Length = 413

 Score = 71.3 bits (167), Expect = 9e-13
 Identities = 35/101 (34%), Positives = 59/101 (58%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++D+G+ F+S   K+L+   G K  F++ YHPQT    ER +  L++ LR+  +
Sbjct: 111 GVPKKIVSDRGSQFTSNFWKKLQEEMGSKLNFSTAYHPQTDRQTERVNQILEDMLRACAL 170

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 171 DFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 211


>04_01_0312 +
           4206400-4206627,4206661-4207269,4207425-4207902,
           4208006-4208297,4209278-4209569,4210013-4210465
          Length = 783

 Score = 71.3 bits (167), Expect = 9e-13
 Identities = 33/105 (31%), Positives = 57/105 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIP+++I+D G++F  +  + L R  G KH  A+PYHPQT G  E S+  +K  L+  + 
Sbjct: 660 GIPRMVISDGGSHFIDKTFRDLLREMGAKHNVATPYHPQTSGQAETSNKQIKNILQKIVN 719

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           +    W   L   + AY +   +  G SP ++++G    +P  ++
Sbjct: 720 KMGTGWKDRLPDTLWAYRTAYKTPIGMSPYQIVYGKSYRLPVELE 764


>03_05_0310 + 23008915-23009841,23010401-23011162
          Length = 562

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 33/105 (31%), Positives = 57/105 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D G++F  +  + L R  G KH  A+PYHPQT G  E S+  +K  L+  + 
Sbjct: 95  GTPRMVISDGGSHFIDKTFRDLLREMGAKHNVATPYHPQTSGQAETSNKQIKNILQKTVN 154

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           +    W   L  A+ AY +   +  G SP ++++G    +P  ++
Sbjct: 155 KMGTGWKDRLPDALWAYRTAYKTPIGMSPYQIVYGKPCRLPVELE 199


>08_02_0360 + 16196712-16197560,16198126-16198875
          Length = 532

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 31/105 (29%), Positives = 56/105 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D G++F  +  + L R  G KH  A+PYHPQT G  E  +  +K  ++  + 
Sbjct: 69  GTPRMVISDGGSHFIDKTFRDLLREMGAKHNVATPYHPQTSGQAETLNKQIKNIMQKTVK 128

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           +    W   L  A+ AY +   +  G SP ++++G    +P  ++
Sbjct: 129 KMGTGWKDRLSDALWAYRTVYKTPIGMSPYQIVYGKSYRLPVELE 173


>11_04_0146 - 14091671-14092357,14092996-14093229
          Length = 306

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 31/95 (32%), Positives = 51/95 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P ++I+D G++F  +  + L +    +H  A+PYHPQT G  E S+  +K  L+  + 
Sbjct: 122 GTPYMVISDGGSHFIDKTFQNLLQELWAQHNIATPYHPQTSGQAETSNKQIKNILQKTVN 181

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           E    W   L  A+ AY +   +  G SP +L++G
Sbjct: 182 EMGKAWKNKLSDALWAYRTAYKTPIGMSPYQLVYG 216


>06_02_0306 + 14115751-14116450,14116882-14117691,14118957-14119141
          Length = 564

 Score = 65.7 bits (153), Expect = 4e-11
 Identities = 31/105 (29%), Positives = 54/105 (51%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D G++F  +  + L R  G KH  A PYHPQT    E S+  +   L+  + 
Sbjct: 24  GTPRMVISDGGSHFIDKTFRDLLRDMGAKHNVAIPYHPQTSSQAETSNKQIMNILQKTVN 83

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           +    W   L  A+ AY +   +  G SP ++++G    +P  ++
Sbjct: 84  KMGTGWKEKLSDALWAYRTTYKTPIGMSPYQIVYGKSCRLPVELE 128


>04_02_0034 -
           8999618-9000358,9001439-9001618,9001666-9003621,
           9004647-9004786,9004871-9005282,9006399-9006638
          Length = 1222

 Score = 65.3 bits (152), Expect = 6e-11
 Identities = 31/95 (32%), Positives = 51/95 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D G +F  E  + L R  G KH  A+PY+PQT G  E S+  +K  L+  + 
Sbjct: 124 GTPRLVISDGGLHFIDETFRHLLRDMGAKHNVATPYYPQTSGQAETSNKQIKNILQKTVN 183

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           +    W   L  A+ +Y +   +  G SP  +++G
Sbjct: 184 KMGIGWKDKLPDALWSYRTAFMTPIGMSPYHIVYG 218


>02_02_0554 - 11434744-11435364,11435741-11436442
          Length = 440

 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 31/105 (29%), Positives = 56/105 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D+G++F  +  + L +  G KH  A+PYHPQT G  E S+  +K  L+  + 
Sbjct: 24  GTPRMVISDRGSHFIDKTFRDLLQDMGAKHNVATPYHPQTSGQAETSNKQIKNILQKTVN 83

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           +    W   L  A+ AY +   +  G S  +++ G    +P  ++
Sbjct: 84  KMGTGWKDKLLDALWAYRTAYKTPIGLSSYQIVCGKSCRLPVELE 128


>01_05_0044 + 17531005-17531739,17532624-17532956,17532968-17533027
          Length = 375

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 31/104 (29%), Positives = 55/104 (52%)
 Frame = -1

Query: 820 IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
           +PK++I+D G++F  +  + L R  G KH  A+PY  QT G  E S+  +K  L+  + +
Sbjct: 32  VPKMVISDGGSHFIEKTFRDLLREMGAKHNVATPYRRQTSGQAETSNKQIKNILQKTVNK 91

Query: 640 NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
               W   L  A+ AY +   +  G SP ++++G    +P  ++
Sbjct: 92  MGTGWKDRLPDALWAYRTAYKTPIGMSPYQIVYGKSCRLPVELE 135


>08_02_0118 +
           12772636-12772910,12773151-12773254,12774097-12774487,
           12774795-12774870,12775030-12775047
          Length = 287

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 30/91 (32%), Positives = 50/91 (54%)
 Frame = -1

Query: 811 IIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQH 632
           ++I+D G++F  +  + L R  G KH  A+PYHPQT G  E S+  +K  L+  + +   
Sbjct: 1   MVISDGGSHFIDKTFRDLLREMGAKHNVATPYHPQTSGQAETSNKQIKNILQKTVNKMGT 60

Query: 631 TWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
            W   L  A+ AY +   +  G SP ++++G
Sbjct: 61  GWKDRLPDALWAYRTAYKTPIGMSPYQIVYG 91


>11_04_0032 + 12545208-12545954
          Length = 248

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 29/103 (28%), Positives = 55/103 (53%)
 Frame = -1

Query: 811 IIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQH 632
           ++I+D G++F  +  +   +  G +H  A+PYHPQT G  E S+  +K  L+  + E   
Sbjct: 1   MVISDGGSHFIDKTFRNFLQELGAQHNIATPYHPQTSGQAETSNKQIKNILQKTVDEMGK 60

Query: 631 TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSL 503
           +W   L  A+ AY +   +  G SP +L++    ++P  ++ +
Sbjct: 61  SWKNKLPDALWAYRTAYKTPIGMSPYQLVYRKTCHLPVELEHM 103


>03_05_0186 + 21731294-21732277
          Length = 327

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 33/101 (32%), Positives = 57/101 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+PK I++DQ + F+S+  K+L      K  F++ YHPQT G  ER +  L++ LR+ ++
Sbjct: 111 GVPKKIVSDQASQFTSKFWKKLLEEMASKLNFSTSYHPQTDGQTERVNQILEDMLRACVL 170

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           +   +    L  A  +YN++  ++   +P E L+G K   P
Sbjct: 171 DFDGSCYKNLPYAEFSYNNSYQASLQMAPYEALYGRKCRTP 211


>04_03_0027 + 9667508-9668800
          Length = 430

 Score = 62.9 bits (146), Expect = 3e-10
 Identities = 28/105 (26%), Positives = 53/105 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+ +I+D G++F  +  +   +  G +H   +PYHP+T G  E  +  +   L+  + 
Sbjct: 317 GTPRTVISDGGSHFIDKTFQNFLQELGAQHNIVTPYHPKTGGQAETRNKQIMNILQKTVN 376

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           E    W   L  A+ AY +  +   G SP +L++G   ++P  ++
Sbjct: 377 EMGKAWKNKLPNALWAYRTTYNMPIGMSPYQLVYGKTCHLPVELE 421


>04_03_0736 -
           19145428-19145474,19145608-19145721,19146707-19147870,
           19150251-19150383
          Length = 485

 Score = 58.8 bits (136), Expect = 5e-09
 Identities = 29/98 (29%), Positives = 53/98 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  I++D+   F+S   ++L RL G++   +S +HPQ+ G  E ++  +  YLR    
Sbjct: 258 GVPASIVSDRDPVFTSTFWRELFRLAGVRLNLSSAFHPQSDGQSEVTNKIIAMYLRCLTG 317

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +    W  +L  A   YN++  S+   SP  +++G +P
Sbjct: 318 DRPRHWLRWLPWAEYCYNTSYQSSLRTSPFRVVYGREP 355


>08_02_0206 + 14286721-14287239,14291236-14291466,14291557-14292030
          Length = 407

 Score = 58.0 bits (134), Expect = 8e-09
 Identities = 27/79 (34%), Positives = 44/79 (55%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D G++F  +  + L R  G KH  A+PYHPQT G  E S+  +K  ++  + 
Sbjct: 69  GTPRMVISDGGSHFIDKTFRDLLREMGAKHNVATPYHPQTSGQAETSNKHIKNIMQKTVN 128

Query: 643 ENQHTWDLYLRTAMLAYNS 587
           +    W   L  A+ AY +
Sbjct: 129 KMGIGWKDILPDALWAYRT 147


>04_04_1405 - 33305948-33309676,33309749-33310468,33310533-33311439,
            33334405-33334484
          Length = 1811

 Score = 57.6 bits (133), Expect = 1e-08
 Identities = 33/108 (30%), Positives = 58/108 (53%), Gaps = 4/108 (3%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL--RSY 650
            G+P  IITD G  F+SE+        GIK  FASP HP++ G +ER+++ + + L  +++
Sbjct: 1585 GVPNRIITDNGTQFTSELFGDYCEDMGIKLCFASPAHPRSNGQVERANAEILKGLKTKTF 1644

Query: 649  IVENQH--TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
             +  +H  +W   L   + A  +     TG +P  L++G +  +P  +
Sbjct: 1645 NILKKHGDSWIEELPAVLWANRTTPSRATGETPFFLVYGAEAVLPSEL 1692


>11_04_0046 + 12751830-12752285,12752385-12752670,12753329-12753786
          Length = 399

 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 25/60 (41%), Positives = 38/60 (63%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D G++F ++  + L R  G KH  A+PYHPQT G  E S+  +K  L+  IV
Sbjct: 95  GTPRMVISDGGSHFINKTFQDLLREMGAKHNVATPYHPQTSGQAETSNKQIKNILQKTIV 154


>02_05_0739 + 31401372-31402371,31402667-31402719
          Length = 350

 Score = 56.4 bits (130), Expect = 3e-08
 Identities = 30/105 (28%), Positives = 55/105 (52%), Gaps = 1/105 (0%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           GIPK I+ D G  F S   + + +   ++  FAS  HPQT GA+ER++  + E ++  + 
Sbjct: 130 GIPKEIVCDNGKQFESGKFQDMCKGLNLQINFASVGHPQTNGAVERANGKIMEAIKKRLE 189

Query: 643 EN-QHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
            + +  W   L + + A  + +  +TG +P  L++G +   P  +
Sbjct: 190 GSAKGKWPEDLLSVLWALRTTVVRSTGMTPFRLVYGDEAMTPSEV 234


>09_06_0375 - 22653366-22657112,22657185-22658457,22658833-22659539
          Length = 1908

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 33/108 (30%), Positives = 58/108 (53%), Gaps = 4/108 (3%)
 Frame = -1

Query: 823  GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYL--RSY 650
            G+P  IITD G  F+SE+        GIK  FASP HP++ G +ER+++ + + L  +++
Sbjct: 1676 GVPNRIITDNGTQFTSELFGDYCEDMGIKLCFASPAHPRSNGQVERANAEIFKGLKTKTF 1735

Query: 649  IVENQH--TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSI 512
             +  +H  +W   L   + A  +     TG +P  L++G +  +P  +
Sbjct: 1736 NILKKHGDSWIEELPAVLWANRTIPSRATGETPFFLVYGAEAVLPSEL 1783


>07_03_0135 +
           14070212-14070311,14072207-14072968,14082526-14082696,
           14082718-14082950,14082966-14083310,14084955-14084966
          Length = 540

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 37/103 (35%), Positives = 51/103 (49%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDL 620
           D+ A F S   + L    G K +F++  HPQT G  E  + TL   LR+ + +N   W+ 
Sbjct: 345 DRDAKFLSHFWRTLWNKLGTKLLFSTTCHPQTDGQTEVVNRTLGTMLRAILKKNLKMWEE 404

Query: 619 YLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNT 491
            L     AYN   HSTT     ++++GF P  P  ID L L T
Sbjct: 405 CLPHMEFAYNRATHSTT-----KVVYGFNPRAP--IDMLPLPT 440


>07_03_0014 -
           12428713-12428860,12429340-12429580,12429664-12430398,
           12430487-12430690,12430764-12431445,12431540-12431796,
           12431872-12432566,12433012-12433172,12434039-12434383,
           12434399-12434631,12434656-12434740
          Length = 1261

 Score = 54.8 bits (126), Expect = 8e-08
 Identities = 36/103 (34%), Positives = 51/103 (49%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDL 620
           D+ A F +   + L    G K +F++  HPQT G  E  + TL   LR+ + +N   W+ 
Sbjct: 29  DRDAKFLNHFWRTLWNKLGAKLLFSTTCHPQTDGQTEVVNRTLGTMLRAILKKNLKMWEE 88

Query: 619 YLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSIDSLDLNT 491
            L     AYN   HSTT     ++++GF P  P  ID L L T
Sbjct: 89  CLPHVEFAYNRATHSTT-----KVVYGFNPRAP--IDILPLPT 124


>10_02_0198 - 6611775-6612611
          Length = 278

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 27/75 (36%), Positives = 43/75 (57%)
 Frame = -1

Query: 745 GIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTG 566
           G K IF++ YHPQT G  ER +  L++ LR+  ++   +WD  L  A  +YN++  ++  
Sbjct: 2   GSKLIFSTAYHPQTDGQTERVNQILEDMLRACALDFGGSWDKNLPYAEFSYNNSYQASLQ 61

Query: 565 FSPLELLFGFKPYIP 521
            +P E L+G K   P
Sbjct: 62  MAPYEALYGRKCRTP 76


>11_04_0010 - 12139533-12139571,12140893-12141230,12141235-12141721
          Length = 287

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 22/66 (33%), Positives = 37/66 (56%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D G++F  +  +   +  G +H  A+PYHPQT G  E S+  +K  L+  + 
Sbjct: 69  GTPRMVISDGGSHFIDKTFRNFLQELGAQHNIAAPYHPQTSGQAEMSNKQIKNILQKTVN 128

Query: 643 ENQHTW 626
           E    W
Sbjct: 129 EMGKAW 134


>02_02_0042 - 6297211-6297981
          Length = 256

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 37/137 (27%), Positives = 65/137 (47%), Gaps = 9/137 (6%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  I+ DQ   FSS   +++ RL G++   +S  HPQ+ G  E ++  +  YLR +  
Sbjct: 113 GVPVSIVIDQDPVFSSPFWREIFRLAGVQPNLSSALHPQSDGQSEVTNKIIVMYLRCFTR 172

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF-----GFKPYIPKS--IDSLD--LNT 491
                W  +   A+  YN +  S+   SP  +++       + Y P S  + ++   L  
Sbjct: 173 NRPCQWLRWQPCAVYCYNMSYQSSLRTSPFRVVYCHELPTLRAYDPSSSRLPAVQQTLQE 232

Query: 490 YSDYIRALNHRLYYSRQ 440
             D++RA   RL  ++Q
Sbjct: 233 RDDFLRAFRDRLEQAQQ 249


>12_02_0003 + 12149032-12149562,12149662-12149732,12150160-12150421
          Length = 287

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 25/94 (26%), Positives = 46/94 (48%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++++D G++F  +  + L    G K    +PYHPQT    E S+  +K  L   + 
Sbjct: 24  GTPRMVVSDGGSHFIDKTFRDLLHKMGAKQDVPTPYHPQTSEQAETSNKQIKNILLKTVN 83

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLF 542
           +    W   L  A+ AY +   +    SP ++++
Sbjct: 84  KMGIGWKDKLSDALWAYRTAYKTPIAMSPYQIVY 117


>07_01_0602 + 4485753-4486751
          Length = 332

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 27/98 (27%), Positives = 52/98 (53%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+   I++D+   F+S   ++L RL G++   +S +HPQ+ G  + ++  +  YLR    
Sbjct: 14  GVLASIVSDRDPVFTSTFWRELFRLTGVQLNLSSAFHPQSDGQSKVTNKIIAMYLRCLTG 73

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +    W  +L  A   YN++  S+   SP  +++G +P
Sbjct: 74  DRPRHWLRWLPWAEYCYNTSYQSSLRTSPFRVVYGREP 111


>12_01_1102 + 11622839-11623341,11623441-11623750
          Length = 270

 Score = 51.6 bits (118), Expect = 7e-07
 Identities = 28/77 (36%), Positives = 42/77 (54%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D G++F  +  + L +    KH  A+PYHPQT G  E S+  +K  L+  I 
Sbjct: 95  GTPRMVISDGGSHFIDKTFRDLLQEMRAKHNVATPYHPQTSGQAETSNKQIKNILQKTIN 154

Query: 643 ENQHTWDLYLRTAMLAY 593
           +    W   L  A LAY
Sbjct: 155 KMGTGWKDRLPDA-LAY 170


>04_01_0251 -
           3294223-3294272,3295189-3295264,3295789-3296052,
           3296278-3296531,3296826-3296929,3297204-3297679
          Length = 407

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 23/66 (34%), Positives = 38/66 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G P+++I+D G++F  +  + L +  G KH  A+PY+PQT G  E S+  +K  ++   V
Sbjct: 95  GTPRMVISDGGSHFIDKTFRDLLQDMGAKHNVATPYYPQTSGQAETSNKQMKNIVQK-TV 153

Query: 643 ENQHTW 626
               TW
Sbjct: 154 NKMGTW 159


>07_03_1435 - 26532302-26533159,26533559-26534902,26535180-26535188
          Length = 736

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 28/109 (25%), Positives = 53/109 (48%), Gaps = 4/109 (3%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  IITD G  F+    K     FGIK  +AS  HP + G +ER++  + + +++ + 
Sbjct: 510 GVPNRIITDNGTQFTGGEFKDFCEDFGIKICYASVAHPMSNGQVERANGMILQGIKAQVF 569

Query: 643 ENQH----TWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIPKSID 509
           +        W   L++ + +  +     T  SP  L++G +  +P  ++
Sbjct: 570 DRLRPYAGKWVDQLQSVLWSLRTTPSRATVQSPFFLVYGAEAMLPSEVE 618


>06_02_0323 +
           14381803-14382091,14382116-14382348,14382364-14382460,
           14382900-14383024
          Length = 247

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 31/90 (34%), Positives = 44/90 (48%)
 Frame = -1

Query: 799 DQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDL 620
           D  A F S   + L    G K +F++  HPQT G  E  + TL   LR+ + +N   W+ 
Sbjct: 97  DCDAKFLSHFWRTLWNKLGTKLLFSTTCHPQTDGQTEVVNRTLGTMLRAILKKNLKMWEE 156

Query: 619 YLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
            L     AYN   HSTT     ++++GF P
Sbjct: 157 CLPHVEFAYNRATHSTT-----KVVYGFNP 181


>12_02_0637 - 21437244-21438080
          Length = 278

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 26/75 (34%), Positives = 41/75 (54%)
 Frame = -1

Query: 745 GIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTG 566
           G K  F + YHPQT G  ER +  L++ LR+  ++   +WD  L  A  +YN++  ++  
Sbjct: 2   GSKLNFRTAYHPQTDGQTERVNQILEDMLRACALDFGGSWDKNLPYAEFSYNNSYQASLQ 61

Query: 565 FSPLELLFGFKPYIP 521
            +P E L+G K   P
Sbjct: 62  MAPYEALYGRKCRTP 76


>06_03_0300 + 19299378-19299688,19299839-19300268
          Length = 246

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 24/85 (28%), Positives = 44/85 (51%)
 Frame = -1

Query: 811 IIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQH 632
           ++I+D G++F ++  +   +  G +H  A+ YHPQT   +E S+  +K  L+  + E   
Sbjct: 161 MVISDGGSHFINKTFRNFLQKLGAQHNIATLYHPQTSRQVETSNRQIKNILQKTVNEMGK 220

Query: 631 TWDLYLRTAMLAYNSNIHSTTGFSP 557
            W   L  A+  Y +  ++  G SP
Sbjct: 221 AWKKRLPDALWEYRTAYNTPIGMSP 245


>10_05_0102 - 9176459-9176767,9176793-9176858
          Length = 124

 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 21/48 (43%), Positives = 31/48 (64%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSH 680
           G P+++I+D G++F  +  + L R  G KH  A+PYHPQT G  E S+
Sbjct: 76  GTPRMVISDGGSHFIDKTFRDLLREMGAKHNVATPYHPQTSGQEETSN 123


>10_07_0030 - 12044953-12045524,12045567-12045876
          Length = 293

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 24/79 (30%), Positives = 39/79 (49%)
 Frame = -1

Query: 745 GIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTG 566
           G KH  A PYHPQT G  E S+  +K  L+  + + +  W   L  A+ AY     ++  
Sbjct: 106 GAKHNMAVPYHPQTSGRAETSNKQIKNILQKTVNKMETGWKDKLSDALWAYQIAYKTSIE 165

Query: 565 FSPLELLFGFKPYIPKSID 509
            SP ++ +G    +P  ++
Sbjct: 166 MSPYQIAYGKPCRLPVELE 184


>07_02_0014 + 11799589-11799788,11799813-11800074
          Length = 153

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 20/52 (38%), Positives = 32/52 (61%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           G P+++I+D G++F  +  ++L R  G KH   + YHPQT G  E S+  +K
Sbjct: 87  GTPRMVISDGGSHFVDKTFRELLRKMGAKHNITTLYHPQTSGQAETSNKQIK 138


>05_03_0427 - 13886814-13887935
          Length = 373

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 24/98 (24%), Positives = 49/98 (50%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIV 644
           G+P  I++D+   F+    ++L RL  ++   +S +HPQ+ G  E  + T+  Y      
Sbjct: 54  GMPMSIVSDRDPVFTGHFWQELFRLTKVQLQISSVFHPQSDGDTEAVNKTIAMYFSCLAS 113

Query: 643 ENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
           +   +W  +L  +   YN++  S    +P ++++G  P
Sbjct: 114 DRPRSWLQWLPWSEYCYNTSFQSFLRETPFKVVYGHDP 151


>05_03_0260 - 11200887-11200907,11200979-11201961,11212201-11212390
          Length = 397

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 32/101 (31%), Positives = 50/101 (49%), Gaps = 4/101 (3%)
 Frame = -1

Query: 814 KIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVENQ 635
           K + +D G  F +  +++     GIKH F++PY P   G +ER + TL E  R+ + E +
Sbjct: 84  KRVRSDNGEEFKNTQVEEFLDEEGIKHEFSAPYDPPQNGIVERKNRTLIEAARAMLDEYK 143

Query: 634 HT---WDLYLRTAMLAYNS-NIHSTTGFSPLELLFGFKPYI 524
            +   W   + TA  A N   +H     +  ELL G KP +
Sbjct: 144 TSDVFWVEAVSTACHAINRLYLHKILKKTSYELLSGKKPNV 184


>12_02_0210 - 15617770-15618453
          Length = 227

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 25/97 (25%), Positives = 45/97 (46%)
 Frame = -1

Query: 820 IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
           IP  I+        S    +L  L  +K   +S +HPQ+ G LE ++  +  YL   I +
Sbjct: 55  IPNSIVVAHDPVTRSMFWPELFHLARVKLNLSSAFHPQSGGQLEAANHVIGVYLWCLIGD 114

Query: 640 NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKP 530
             H W  +     + +NS   S+   +P ++++G+ P
Sbjct: 115 RPHHWLRWFPWEEICFNSAYRSSLRSNPFQVVYGWPP 151


>01_05_0591 + 23481400-23481479,23481518-23482538,23482574-23482996
          Length = 507

 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRS 653
           G+P  IITD G  F+  V K     FGIK  +AS  HP + G +ER++  + + +++
Sbjct: 451 GVPNRIITDNGTQFTGGVFKDFCEDFGIKICYASVAHPMSNGQVERANGMVLQGIKA 507


>01_05_0015 - 17164024-17164193,17164308-17164713
          Length = 191

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 18/40 (45%), Positives = 27/40 (67%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQT 704
           G P+++I+D G++F  +  + L R  G KH  A+PYHPQT
Sbjct: 95  GTPRMVISDGGSHFIDKTFRNLLREKGAKHNVATPYHPQT 134


>09_01_0107 - 1683618-1684028
          Length = 136

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 16/42 (38%), Positives = 27/42 (64%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCG 698
           G P++ I+D G++F  +  ++  +  G +H  A+PYHPQT G
Sbjct: 95  GTPRMAISDGGSHFIDKTFRKFLQELGAQHNIATPYHPQTSG 136


>04_01_0591 + 7806693-7807091
          Length = 132

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 16/38 (42%), Positives = 25/38 (65%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHP 710
           G P+++I+D G++F  +  + L R  G KH  A+PYHP
Sbjct: 95  GTPRMVISDGGSHFIDKTFRDLLRDLGAKHNVATPYHP 132


>01_05_0111 -
           18230195-18230239,18230541-18230615,18231379-18231566,
           18232416-18232739,18232926-18233115
          Length = 273

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 16/40 (40%), Positives = 26/40 (65%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQT 704
           G P+++I+D G++F  +  + L R  G K   A+PYHP+T
Sbjct: 24  GTPRMVISDGGSHFIDKTFQDLLREMGTKQNVATPYHPET 63


>08_02_0107 +
           12494650-12495270,12507463-12508146,12508325-12508472,
           12508493-12508584,12508713-12509426
          Length = 752

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/62 (32%), Positives = 34/62 (54%)
 Frame = -1

Query: 706 TCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPY 527
           T G  ER +  L++ LR+ +++   TWD  L  A  +YN++  ++   +P E L+G K  
Sbjct: 516 TDGQTERLNQILEDMLRACVLDFAKTWDKSLPYAEFSYNNSYQASIQMAPYEALYGRKCR 575

Query: 526 IP 521
            P
Sbjct: 576 TP 577


>12_01_0516 - 4088717-4089181
          Length = 154

 Score = 37.9 bits (84), Expect = 0.010
 Identities = 19/65 (29%), Positives = 31/65 (47%)
 Frame = -1

Query: 820 IPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYIVE 641
           +P  I++D+   F+S   + L    G K   +S +HPQT G  E  +  +  YLR  + +
Sbjct: 88  VPASIVSDRDPVFTSTFWQALFAATGTKLHMSSVFHPQTDGQSEAVNKAIAMYLRCLVGD 147

Query: 640 NQHTW 626
               W
Sbjct: 148 RPRQW 152


>04_01_0293 + 3881375-3883698,3906619-3907636,3907820-3908309,
            3914729-3914823,3914854-3915213
          Length = 1428

 Score = 36.7 bits (81), Expect = 0.022
 Identities = 19/65 (29%), Positives = 34/65 (52%)
 Frame = -1

Query: 706  TCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPY 527
            T G  ER +  L++ LR+  ++   +WD  L  A  +YN++  ++   +P E L+G K  
Sbjct: 1115 TDGQTERVNQILEDMLRACALDFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCR 1174

Query: 526  IPKSI 512
             P  +
Sbjct: 1175 TPYEV 1179


>10_05_0084 + 8956637-8956681,8957722-8957856,8958040-8958834
          Length = 324

 Score = 36.3 bits (80), Expect = 0.030
 Identities = 19/62 (30%), Positives = 33/62 (53%)
 Frame = -1

Query: 706 TCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPY 527
           T G  ER +  L++ LR+  ++   +WD  L  A  +YN++  ++   +P E L+G K  
Sbjct: 61  TDGQTERVNQILEDMLRACALDFGGSWDKNLPYAEFSYNNSYQASLQMAPYEALYGRKCR 120

Query: 526 IP 521
            P
Sbjct: 121 TP 122


>05_03_0317 - 12249228-12249275,12263876-12264518,12264954-12266682,
            12283603-12283975,12284119-12284715
          Length = 1129

 Score = 36.3 bits (80), Expect = 0.030
 Identities = 15/46 (32%), Positives = 25/46 (54%)
 Frame = -1

Query: 658  RSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
            R+ + +N   W+  L     AYN ++HSTT   P ++++G  P  P
Sbjct: 900  RAVLKKNIKMWEECLPHIEFAYNRSLHSTTKMCPFQIVYGLLPRAP 945


>01_05_0320 -
           20874691-20875230,20879337-20879590,20880014-20881087,
           20881259-20881511,20881548-20882369
          Length = 980

 Score = 36.3 bits (80), Expect = 0.030
 Identities = 18/56 (32%), Positives = 27/56 (48%)
 Frame = -1

Query: 814 KIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           K + +D+G  + S         FGI H    PY PQ+ G  ER + TL E + + +
Sbjct: 450 KRLRSDRGGEYFSNEFASFCEEFGIIHEMTPPYSPQSNGVAERKNRTLTEMVNAML 505


>12_01_1034 - 10638984-10639376,10639905-10640093
          Length = 193

 Score = 35.9 bits (79), Expect = 0.039
 Identities = 13/40 (32%), Positives = 24/40 (60%)
 Frame = -1

Query: 823 GIPKIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQT 704
           G P+++I+D G++F  +  +   +    +H   +PYHPQT
Sbjct: 152 GTPRMVISDGGSHFIDKTFRNFLQELRAQHNIPTPYHPQT 191


>07_01_1097 -
           10068431-10068655,10068797-10068880,10068945-10069292,
           10069477-10069510,10069617-10070230,10079179-10079553,
           10079599-10079853,10079983-10080300
          Length = 750

 Score = 35.5 bits (78), Expect = 0.052
 Identities = 17/56 (30%), Positives = 31/56 (55%)
 Frame = -1

Query: 706 TCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFG 539
           T G  ER++  L++ LR+  ++    W+  L  A  ++N++  ++   SP E LFG
Sbjct: 107 TDGQTERTNQVLEDMLRACALDFSKDWERCLPYAEFSHNNSFQASLKMSPNEALFG 162


>08_01_0732 - 6672839-6672937,6672990-6673571,6673755-6674417
          Length = 447

 Score = 35.1 bits (77), Expect = 0.068
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = -1

Query: 706 TCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPY 527
           T G  ER +  L++ LR+  ++   +WD  L     +YN++  ++   +P E L+G K  
Sbjct: 222 TDGQTERVNQVLEDMLRACTLDFGGSWDKNLPYVEFSYNNSYQASLHMAPYEALYGRKCR 281

Query: 526 IP 521
            P
Sbjct: 282 TP 283


>03_05_0179 -
           21583234-21584336,21586274-21586358,21586665-21586713,
           21586801-21586874,21586958-21587050,21587120-21587174,
           21587348-21587421,21587702-21587814,21587911-21588168,
           21588915-21589012,21589139-21589256,21589754-21589848,
           21590001-21590159,21590336-21590525,21590881-21591021,
           21591142-21591176,21591659-21591699
          Length = 926

 Score = 34.7 bits (76), Expect = 0.090
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 7/134 (5%)
 Frame = -2

Query: 540 GLNPTSL--KV*TLSTLIHTATI*EHLITGYITAVKKLYKI*SRQKKKDPRPPNSA---- 379
           GL+ T++  KV   S  I   T      + +IT VKK  KI   + +K+ RP   A    
Sbjct: 345 GLSGTAMIRKVLPGSNKIRGVTALFEAASRHITEVKKKKKIAPEEVEKEFRPGVDAHDGR 404

Query: 378 AADPVVVLQPVPHMV*HAGAVLQPV-SHADAEARVTDAARVDLAHTEDPGAVH*QAAEVT 202
           A   +  + P+PH+    G +   + + AD +  +      DLA  +  G  + Q    T
Sbjct: 405 AGKKLTNMIPIPHIPKINGDIPSAIEAFADHQRLLDRLVLYDLAEVKVKGDRNCQHVSFT 464

Query: 201 EHATINSQTFHTSD 160
           +   ++ Q +HT++
Sbjct: 465 QFRALSDQMYHTTE 478


>01_04_0007 -
           15038268-15039062,15039177-15039711,15039887-15039936,
           15040376-15040446,15040683-15040731
          Length = 499

 Score = 34.7 bits (76), Expect = 0.090
 Identities = 18/62 (29%), Positives = 32/62 (51%)
 Frame = -1

Query: 706 TCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPY 527
           T G  ER +  L++ L++  ++    WD  L  A  +YN++  ++   +P E L+G K  
Sbjct: 236 TDGQTERVNQILEDMLQACALDFGGAWDKSLPYAEFSYNNSYQASLQMAPFEALYGRKCR 295

Query: 526 IP 521
            P
Sbjct: 296 TP 297


>12_01_0737 - 6588612-6588922,6595261-6596602,6596639-6596749
          Length = 587

 Score = 33.9 bits (74), Expect = 0.16
 Identities = 18/56 (32%), Positives = 27/56 (48%)
 Frame = -1

Query: 814 KIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           K + +D+G  + S         FGI H    PY PQ+ G  ER + TL E + + +
Sbjct: 270 KRLRSDRGREYFSNEFASFCEEFGIIHERTPPYLPQSNGVAERKNRTLAEIVNAML 325


>01_01_0914 - 7208910-7209449,7209488-7209919
          Length = 323

 Score = 33.5 bits (73), Expect = 0.21
 Identities = 19/68 (27%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = -1

Query: 697 ALERSHSTLKEYLRSYIVE-NQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           A+ER++  +   L   +V+ ++ TW   L      + +++   TGF+P +LLFG +   P
Sbjct: 148 AVERANGNILSSLNKRLVDASRGTWADELPAVQWGHCTSVTWATGFTPFKLLFGDEAMTP 207

Query: 520 KSIDSLDL 497
             I    L
Sbjct: 208 AEIKGQSL 215


>07_01_1177 + 11125945-11126242,11126465-11128303,11128342-11128358
          Length = 717

 Score = 33.1 bits (72), Expect = 0.28
 Identities = 17/48 (35%), Positives = 22/48 (45%)
 Frame = -1

Query: 814 KIIITDQGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTL 671
           K++ TD G  F S+      R  GI      PY PQ  G  ER + T+
Sbjct: 475 KVLRTDNGGEFCSDAFDDYCRKEGIVRHHTIPYTPQQNGVAERMNRTI 522


>01_05_0003 -
           16841745-16841912,16842005-16842259,16842938-16843085,
           16843740-16843854,16844294-16844465,16844481-16844617,
           16844738-16844792
          Length = 349

 Score = 32.7 bits (71), Expect = 0.36
 Identities = 25/72 (34%), Positives = 34/72 (47%)
 Frame = -1

Query: 706 TCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPY 527
           T G  E  + TL   LR+ + +N   W+  L     AYN   HSTT     ++++GF   
Sbjct: 18  TDGQTEVVNRTLGTMLRAILKKNLKMWEECLPHVEFAYNRATHSTT-----KVVYGFNTR 72

Query: 526 IPKSIDSLDLNT 491
            P  ID L L T
Sbjct: 73  AP--IDILPLPT 82


>12_02_0973 + 24959440-24959451,24959962-24962195,24962539-24962653,
            24963146-24963943,24964140-24964422,24964500-24964951,
            24965744-24965870,24965950-24966074,24966188-24966858,
            24966976-24967093,24967177-24967293,24967564-24967658,
            24968152-24968303,24968858-24968913,24969001-24969218,
            24969842-24970239,24970345-24970628,24970730-24970836,
            24970882-24970968,24971729-24971990,24972228-24972503,
            24973197-24973254,24973437-24973756,24973889-24973999,
            24974183-24974350,24974494-24974622,24974731-24974820,
            24974934-24975040,24975133-24975281,24975584-24975666,
            24975749-24975844,24975957-24976079,24976180-24976263,
            24976371-24976511,24976652-24976951,24977386-24977453,
            24977540-24977642,24979363-24979524,24979613-24981230,
            24981270-24981661,24981689-24981991,24982078-24982161,
            24982296-24982448,24982678-24982841,24982915-24983062,
            24983209-24983331,24983409-24983496,24983686-24983867
          Length = 4177

 Score = 29.5 bits (63), Expect = 3.4
 Identities = 21/54 (38%), Positives = 28/54 (51%)
 Frame = -1

Query: 685  SHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYI 524
            S S ++EYL     +N  T+D     A  + NS + S+TG  PLE L   K YI
Sbjct: 1211 SQSEIQEYLPFLEADNVLTYD---HDAPSSSNSTVESSTGNPPLE-LSSHKSYI 1260


>02_03_0058 + 14536336-14536593,14536715-14536984
          Length = 175

 Score = 29.1 bits (62), Expect = 4.5
 Identities = 15/68 (22%), Positives = 30/68 (44%)
 Frame = -1

Query: 712 PQTCGALERSHSTLKEYLRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFK 533
           P+TCG  E  +  +K  L+  + +    W   L  A+ AY +   +  G     +++G  
Sbjct: 85  PKTCGQAEILNKQIKNILQKTVNKMATRWKDRLPDALWAYRTAYKTPIGMFRYHIVYGKS 144

Query: 532 PYIPKSID 509
             +P  ++
Sbjct: 145 CRLPVELE 152


>09_04_0394 - 17261008-17262476,17262554-17262743
          Length = 552

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 14/29 (48%), Positives = 16/29 (55%)
 Frame = +2

Query: 113 KPNEGRRRNRFVPSLLSDVWNVWLLIVAC 199
           KP    RR   +PS  S VW V LL+V C
Sbjct: 4   KPTRPHRRPPPLPSKTSGVWPVALLVVLC 32


>08_01_0083 - 604175-605776
          Length = 533

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = -3

Query: 329 TPAPFFNRYHTQTQKLGLQTPPG*TSHI-QKIQEPFIDK 216
           TPAP F R+  +T  + +  P G   HI ++++ P + +
Sbjct: 218 TPAPVFRRWFVETSPVPIPMPVGKLQHIVRRLERPEVQE 256


>08_01_0082 - 588269-588434,590800-591653
          Length = 339

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = -3

Query: 329 TPAPFFNRYHTQTQKLGLQTPPG*TSHI-QKIQEPFIDK 216
           TPAP F R+  +T  + +  P G   HI ++++ P + +
Sbjct: 221 TPAPVFRRWFVETSPVPIPMPVGKLQHIVRRLERPEVQE 259


>06_03_0310 -
           19453047-19453160,19453240-19453338,19453441-19453513,
           19453598-19453708,19453795-19453956,19454064-19454340,
           19454542-19455160,19455256-19455471
          Length = 556

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 19/58 (32%), Positives = 22/58 (37%), Gaps = 2/58 (3%)
 Frame = -2

Query: 399 PRPPNSAAADPVVVLQPVPHMV*HAGAVLQPVSHAD--AEARVTDAARVDLAHTEDPG 232
           P PP + A  P     P P             S A   A  R T  A+VD A  +DPG
Sbjct: 181 PTPPQAPAPTPPRAPTPTPPQAPLPAPSKSRASQAPPPAHTRATKKAKVDAAKNKDPG 238


>02_03_0388 +
           18429538-18430598,18430971-18431081,18431165-18431237,
           18431513-18431695
          Length = 475

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 18/58 (31%), Positives = 22/58 (37%), Gaps = 2/58 (3%)
 Frame = -2

Query: 399 PRPPNSAAADPVVVLQPVPHMV*HAGAVLQ--PVSHADAEARVTDAARVDLAHTEDPG 232
           P PP + A  P     P P             P +   A  R T  A+VD A  +DPG
Sbjct: 97  PSPPQAPAMTPPQAPAPTPPQAPRPAPSKSRAPQAPPPAPTRATKKAKVDTAKNKDPG 154


>11_03_0201 + 11578163-11578915
          Length = 250

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = -1

Query: 661 LRSYIVENQHTWDLYLRTAMLAYNSNIHSTTGFSPLELLFGFKPYIP 521
           LR+  ++    WD  L  A  +YN++  ++   +P E L+G K   P
Sbjct: 2   LRACALDFGGAWDKSLPYAEFSYNNSYEASLQMAPFEALYGRKCRTP 48


>06_03_0372 - 20013078-20013533,20013969-20014062,20014247-20014422
          Length = 241

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 13/41 (31%), Positives = 19/41 (46%)
 Frame = -1

Query: 790 ANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLK 668
           A       K   +  G +H  A+PY PQT G +E  +  +K
Sbjct: 85  ARCQKHTSKNFLQELGAQHNIATPYRPQTGGKVETYNKQIK 125


>04_04_0964 -
           29749624-29749649,29749742-29749945,29750036-29750634,
           29750742-29750826,29750914-29751562,29751568-29751643,
           29753891-29753957,29754097-29754998,29756579-29756790
          Length = 939

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 16/50 (32%), Positives = 23/50 (46%)
 Frame = -1

Query: 796 QGANFSSEVMKQLERLFGIKHIFASPYHPQTCGALERSHSTLKEYLRSYI 647
           +GA   +E+ K  +   G     ASP  P   G +E   S  K++ R YI
Sbjct: 827 EGAAVPAEISKDPDHENGSSSHDASPTKPPNDGNIENDASPAKQFEREYI 876


>01_05_0339 + 21135250-21135467,21136465-21137513,21137905-21138962
          Length = 774

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = -2

Query: 210 EVTEHATINSQTFHTSDSSEGTKRFRRLPSF 118
           +++EH T  S+  HT  S+   ++ RRL SF
Sbjct: 696 KISEHDTDKSRRPHTKKSATSPRKMRRLSSF 726


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,933,510
Number of Sequences: 37544
Number of extensions: 384694
Number of successful extensions: 1089
Number of sequences better than 10.0: 85
Number of HSP's better than 10.0 without gapping: 1064
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1089
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2268190812
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).