SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0037
         (740 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

12_01_0882 - 8495717-8495761,8496414-8496860                           33   0.31 
08_02_0940 - 22822391-22822781,22822875-22823053,22823079-228234...    31   0.73 
06_03_0615 - 22761375-22761760,22762218-22765026                       31   0.73 
07_03_0331 - 16878602-16879054                                         30   1.7  
06_02_0325 + 14428065-14428799,14428916-14428993,14429607-144298...    30   2.2  
03_06_0713 - 35687672-35689219                                         30   2.2  
02_01_0163 + 1135592-1135623,1135718-1135816,1135904-1135960,113...    29   2.9  
05_04_0090 + 17833897-17834364                                         29   3.9  
03_05_0702 - 26934736-26935551,26937494-26937538,26938484-26938594     29   3.9  
06_01_0486 - 3455030-3455770                                           29   5.1  
02_04_0449 + 23010099-23010317,23010873-23010934,23011399-230114...    29   5.1  
01_06_0614 + 30621495-30621670,30621817-30622036,30623848-306242...    29   5.1  
12_02_1091 - 26001129-26001181,26001292-26001325,26001339-260014...    28   6.8  
10_08_1037 - 22477358-22478752                                         28   6.8  
09_02_0603 - 11150739-11150746,11150791-11151340                       28   6.8  
08_01_0068 + 471729-472460,472578-472655,473270-473507,474130-47...    28   6.8  
11_06_0264 - 21785450-21786928                                         28   9.0  
08_02_0597 + 19132492-19133230,19133827-19134371,19134563-19135264     28   9.0  
05_03_0032 - 7582595-7582690,7582879-7583004,7583119-7583185,758...    28   9.0  

>12_01_0882 - 8495717-8495761,8496414-8496860
          Length = 163

 Score = 32.7 bits (71), Expect = 0.31
 Identities = 18/52 (34%), Positives = 24/52 (46%)
 Frame = -2

Query: 211 ARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTALLDSYLQNPTCIESL 56
           AR RGA  +   GG  A   R  P P  ++S P P+A      + PT +  L
Sbjct: 82  ARGRGAAGARRRGGLLAALDRRRPAPPPRRSRPPPSAEASDARRQPTVVRGL 133


>08_02_0940 -
           22822391-22822781,22822875-22823053,22823079-22823428,
           22823522-22823765
          Length = 387

 Score = 31.5 bits (68), Expect = 0.73
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 2/67 (2%)
 Frame = +3

Query: 129 SPGTGSARRWSAAVPPGLAEFVAPLQRAGLCLLAHQPHAVGAWTVYMGR--ASPLTAARP 302
           +P T S    +AA  P      AP   A   + + +PH   ++          PLTAA+P
Sbjct: 322 NPATASTSAPAAATSPA----AAPTAAARTAVASPEPHRPSSFAALFAAPLGFPLTAAQP 377

Query: 303 RPTYPAT 323
           RP  PA+
Sbjct: 378 RPPPPAS 384


>06_03_0615 - 22761375-22761760,22762218-22765026
          Length = 1064

 Score = 31.5 bits (68), Expect = 0.73
 Identities = 17/42 (40%), Positives = 20/42 (47%)
 Frame = +1

Query: 199 PCSGRGCVCSHTSRTRSARGPCTWAERPRLPPPVPDRHILQL 324
           PCS +G  CS  SR  S   P T+     LPP +     LQL
Sbjct: 58  PCSWQGVTCSPQSRVVSLSLPNTFLNLSSLPPQLASLSSLQL 99


>07_03_0331 - 16878602-16879054
          Length = 150

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 21/63 (33%), Positives = 24/63 (38%), Gaps = 1/63 (1%)
 Frame = -2

Query: 328 YVVAGYVGRGRAAVS-GDARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHL 152
           +  A  VG  R AV+ G    +    AP   GWC SRH  A           GG A   L
Sbjct: 59  WCAAAIVGGHRGAVADGGGSQLGADAAPY--GWCMSRHQEAAAAAEEEEEEGGGGAGGEL 116

Query: 151 RAE 143
             E
Sbjct: 117 ATE 119


>06_02_0325 +
           14428065-14428799,14428916-14428993,14429607-14429844,
           14431199-14431296,14431770-14432063,14432418-14432702
          Length = 575

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = -2

Query: 316 GYVGRGRAAVSGDARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRA-EP 140
           G  G+ +A+ + DA PM ++ +P+     AS  SP+      N  SP    AD+     P
Sbjct: 10  GKKGKSKASTTADASPM-SLSSPSTVD--ASSKSPSSPSTEENGTSPAHHQADNAPVIAP 66

Query: 139 VPGDQQSGPQP 107
            P  + + P+P
Sbjct: 67  PPVPEPAPPEP 77


>03_06_0713 - 35687672-35689219
          Length = 515

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 4/73 (5%)
 Frame = -2

Query: 247 TACGWCASRHS--PARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTALLDSY--LQ 80
           T C     R S  PAR RG  +   P   AA  LRA P P  Q +  +  + L S+  L 
Sbjct: 10  TTCAIQRRRRSTAPARRRGPPSRRHPHSGAALTLRAAPPPATQPTLDRVLSDLGSHPRLL 69

Query: 79  NPTCIESL*LFLP 41
            P  ++SL   LP
Sbjct: 70  TPDLLDSLLAALP 82


>02_01_0163 +
           1135592-1135623,1135718-1135816,1135904-1135960,
           1136053-1136116,1136174-1136392,1138562-1138945
          Length = 284

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%)
 Frame = +1

Query: 196 PPCSGRGCVCSH-TSRTRSARGPCTWAERPRLPPPVPDRHIL 318
           PP +G   V +  T  T++A  P T A  P   P +PD   L
Sbjct: 224 PPQAGAEAVTTESTEATQAANPPATTASNPHQAPVIPDEETL 265


>05_04_0090 + 17833897-17834364
          Length = 155

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 20/64 (31%), Positives = 25/64 (39%)
 Frame = -2

Query: 319 AGYVGRGRAAVSGDARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRAEP 140
           +G  G GR A  GDAR     H  T      +RH   R R  +N      +     R+ P
Sbjct: 47  SGAAGVGRGA-GGDARRGVGRHRQTWSEAAGARHGAGRVRARSNDGEATRSTVRLRRSLP 105

Query: 139 VPGD 128
            P D
Sbjct: 106 APRD 109


>03_05_0702 - 26934736-26935551,26937494-26937538,26938484-26938594
          Length = 323

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = +3

Query: 45  RNSYNDSIHVGFCRYESRRAVGWGPDC*SPGTGSARRWSAA 167
           R    D    G C +E  RA  W  DC +PG G + R+S++
Sbjct: 119 RGGRGDGPPPGNC-FECGRAGHWARDCPNPGGGRSARYSSS 158


>06_01_0486 - 3455030-3455770
          Length = 246

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 12/26 (46%), Positives = 14/26 (53%)
 Frame = +3

Query: 102 AVGWGPDC*SPGTGSARRWSAAVPPG 179
           A GW  DC  PG+GS+       PPG
Sbjct: 20  AHGWNKDCPPPGSGSSGGGHHGKPPG 45


>02_04_0449 +
           23010099-23010317,23010873-23010934,23011399-23011450,
           23011803-23011917,23012024-23012118,23012852-23012958,
           23013042-23013156,23014159-23014203,23014324-23014392
          Length = 292

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 1/45 (2%)
 Frame = -2

Query: 223 RHSPARCRGATNSASPGGTAADHLRAEPV-PGDQQSGPQPTALLD 92
           +H  +   GA  SASP    A   R +   P  + S P+P +LLD
Sbjct: 28  KHQASSSSGAAASASPPSPPAKRQRGDDAAPKGRGSKPKPASLLD 72


>01_06_0614 +
           30621495-30621670,30621817-30622036,30623848-30624270,
           30624523-30624906,30624991-30625086,30625161-30625276,
           30625431-30625598,30625685-30625844,30625999-30626196,
           30626304-30626432,30626595-30626673,30627010-30627119
          Length = 752

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 15/52 (28%), Positives = 25/52 (48%)
 Frame = +1

Query: 568 IIVYSDCLRFVLFDVFAILYEETLLISLCIPVCMYVSRMYIGMYVCLSYVYR 723
           +IV+ +CL  +      + Y  T  + L +PVC+YV    +  +   SY  R
Sbjct: 384 LIVHGECLYLI-----HVWYRRTTWMYLSVPVCLYVGERILRFFRSGSYSVR 430


>12_02_1091 -
           26001129-26001181,26001292-26001325,26001339-26001437,
           26002327-26002369,26002389-26002494,26002776-26002818,
           26003526-26003579,26003831-26003911,26003997-26004119,
           26004197-26004846,26004928-26005554,26005633-26005870,
           26006082-26006258,26006373-26006723,26006824-26007111,
           26008340-26008462,26008551-26009007,26009115-26009263,
           26009466-26009489
          Length = 1239

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 1/21 (4%)
 Frame = -2

Query: 238 GWCASRHSPARCRG-ATNSAS 179
           GWC+ RH  A C G  T SAS
Sbjct: 57  GWCSDRHQVASCSGDQTQSAS 77


>10_08_1037 - 22477358-22478752
          Length = 464

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = -2

Query: 223 RHSPARCRGATNSASPGGTAADHLRAEPVPGDQQSGPQPTAL 98
           RHSPA  RG    ASP      H    P+P   Q  P+P ++
Sbjct: 227 RHSPAAHRGDPLPASPPQPQHQHHPHRPLPPQHQQ-PKPPSM 267


>09_02_0603 - 11150739-11150746,11150791-11151340
          Length = 185

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 128 SAVRPPANRPPRL 90
           SA RPPA+RPPRL
Sbjct: 18  SAARPPASRPPRL 30


>08_01_0068 +
           471729-472460,472578-472655,473270-473507,474130-474205,
           474820-474961,475326-475619,476037-476249
          Length = 590

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = -2

Query: 316 GYVGRGRAAVSGDARPMYTVHAPTACGWCASRHSPARCRGATNSASPGGTAADHLRA-EP 140
           G  G+ +A+++ DA PM +  +P+     AS  SP+      N  SP    AD+     P
Sbjct: 10  GKKGKLKASITADASPM-SPSSPSTVD--ASSKSPSSPSTEENGTSPAHHQADNAPVIAP 66

Query: 139 VPGDQQSGPQP 107
            P  + + P+P
Sbjct: 67  PPVPEPAPPEP 77


>11_06_0264 - 21785450-21786928
          Length = 492

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = -2

Query: 199 GATNSASPGGTAADHLRAEPVPGDQQSGPQPTALL 95
           GA +S+SP   A   L + P P    SGP+PT  L
Sbjct: 301 GAASSSSPSPVARTVL-SSPSPHQYSSGPKPTQYL 334


>08_02_0597 + 19132492-19133230,19133827-19134371,19134563-19135264
          Length = 661

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 3/51 (5%)
 Frame = +2

Query: 596 LSCLMSLLFS---TRKLCLYRYVYRYVCMSLVCISACMYVSRMYIGMYVCL 739
           L   +SLL+S   +R++ + RYVY+ + + ++  SA   V+   +GMYV L
Sbjct: 533 LLATVSLLYSGMPSREISI-RYVYQSLSLVMMRSSATSLVAAFALGMYVVL 582


>05_03_0032 -
           7582595-7582690,7582879-7583004,7583119-7583185,
           7583268-7583470
          Length = 163

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 23/63 (36%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = -2

Query: 316 GYVGRGRAAVSGDARPMYTVHAPTAC--GWCASRHSPARCRGATNSASPGGTAADHLRAE 143
           GY GRG    SG++   Y+   PT    GW A+R       G  +    GG A   L AE
Sbjct: 35  GYGGRGPRGCSGESPRGYSNSKPTGTVEGWVAARLGKWVACGGDDG---GGFAKCLLDAE 91

Query: 142 PVP 134
            VP
Sbjct: 92  FVP 94


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,851,796
Number of Sequences: 37544
Number of extensions: 431052
Number of successful extensions: 1564
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 1494
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1563
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1957111448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).