SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0036
         (830 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_02_0214 + 13141213-13143741                                         28   7.9  
02_05_1168 + 34651143-34651424,34651983-34652138,34652239-346523...    28   7.9  

>06_02_0214 + 13141213-13143741
          Length = 842

 Score = 28.3 bits (60), Expect = 7.9
 Identities = 15/46 (32%), Positives = 22/46 (47%)
 Frame = -1

Query: 248 FKSLKKYENARNYIKTNNFVFPLMSPPSDGFLLYFFKFILYQSLGL 111
           F +   Y+ AR +   +++ FP+         LYFF F  YQS  L
Sbjct: 83  FDNSALYQTARIFTSPSSYTFPIQKQGRHFVRLYFFAF-AYQSYDL 127


>02_05_1168 +
           34651143-34651424,34651983-34652138,34652239-34652346,
           34652778-34652888,34652985-34654421,34654598-34654852
          Length = 782

 Score = 28.3 bits (60), Expect = 7.9
 Identities = 16/53 (30%), Positives = 25/53 (47%)
 Frame = +3

Query: 468 TTPFRLYLRHVSGVLARQQPQLLSIRSRTKRSPVRTPSRSRLIGNYALYNLSQ 626
           T   R  L  +   + RQQ +LL+++ R K      P +  +IG   L  LS+
Sbjct: 349 TQSLRTELMKMEEKMLRQQQELLALQQRLKEVEREKPVQQDIIGGRLLARLSE 401


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,215,089
Number of Sequences: 37544
Number of extensions: 397340
Number of successful extensions: 823
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 799
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 823
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2291695380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).