SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0035
         (754 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_03_1752 - 29218348-29218524,29218593-29218736,29218957-292191...    35   0.060
01_05_0636 + 23852985-23853142,23853253-23853445,23853910-238540...    32   0.56 
01_06_0929 + 33091184-33091510,33092503-33092646,33093054-33097001     31   1.3  
11_06_0707 + 26467214-26470309                                         30   2.3  
11_06_0698 + 26385989-26389090                                         30   2.3  
09_05_0005 + 20026190-20026343,20026483-20026682,20026918-200273...    29   3.0  
12_01_0038 - 312152-312748,312930-313362,313572-314440,314535-31...    29   4.0  
11_01_0039 - 290960-291086,291615-291714,291809-292013,292466-29...    29   4.0  
10_08_0513 + 18460095-18460170,18460362-18460441,18461029-184614...    29   4.0  
11_04_0374 + 16923063-16923176,16923214-16923363,16923547-16924101     29   5.2  
03_03_0266 - 16014740-16015045,16015566-16015601,16015623-160156...    29   5.2  
01_01_0463 - 3424951-3425065,3425191-3425258,3425362-3425586,342...    29   5.2  
02_01_0632 + 4740052-4740969,4742383-4743009                           28   6.9  
10_01_0075 - 979335-979954,980136-980405,980949-980989,981563-98...    28   9.2  
01_01_0827 + 6443319-6446085,6446317-6446407,6446502-6448017,644...    28   9.2  

>07_03_1752 -
           29218348-29218524,29218593-29218736,29218957-29219148,
           29219225-29219440,29219873-29220010,29220137-29220232,
           29221204-29221357,29221976-29222098,29222291-29222418,
           29222669-29222773,29223396-29223437,29223631-29223746,
           29223805-29223916
          Length = 580

 Score = 35.1 bits (77), Expect = 0.060
 Identities = 27/119 (22%), Positives = 53/119 (44%)
 Frame = -3

Query: 650 NSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTLMXXXXXXXXXXXRCPTEHSLAIY 471
           N FN  + ++F  +A V  ++I ++ +  L P    L              P+   +A+ 
Sbjct: 242 NVFNPMLAAIFSGNAAV--IKIMNRASDTLIPVTLELGGKDAFIVCEDVDLPSVVQVAVR 299

Query: 470 KALRNRCNRLCRDAKRLYFHKSLENRSPAHTWRFLKSVGIGKTPVSSVKDTDLCALNKH 294
            AL++   + C  A+R Y HK + +   +   + +KS+ +G  P+S   D     + +H
Sbjct: 300 AALQSS-GQNCAGAERFYVHKDIYSTFVSQVVKIIKSISVG-PPLSGRYDMGAICMIEH 356


>01_05_0636 +
           23852985-23853142,23853253-23853445,23853910-23854033,
           23854285-23854637,23855525-23856530,23856892-23857085,
           23857238-23857324
          Length = 704

 Score = 31.9 bits (69), Expect = 0.56
 Identities = 12/30 (40%), Positives = 20/30 (66%)
 Frame = -3

Query: 131 IDNVCSKMIALILPTVAPILTDIFNFSFTS 42
           IDN+C + +AL  PT  P+L + ++  F+S
Sbjct: 181 IDNICDESLALFPPTPPPVLVENYHEGFSS 210


>01_06_0929 + 33091184-33091510,33092503-33092646,33093054-33097001
          Length = 1472

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 2/83 (2%)
 Frame = -3

Query: 338 VSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRIPIFELSPVSVAD--VRN 165
           + +++DT+  AL KH +     + +      L KI+   V R+    L+  +V     RN
Sbjct: 535 LENMEDTEFLALFKHHAFSGTEIKNPQLRGRLEKIAEKIVNRLGHSPLAASTVGSQLSRN 594

Query: 164 SFFSISSTAVGIDNVCSKMIALI 96
              ++  +A+ I+N+   M AL+
Sbjct: 595 KDINLWKSALNIENLSEPMKALL 617


>11_06_0707 + 26467214-26470309
          Length = 1031

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 12/44 (27%), Positives = 26/44 (59%)
 Frame = +1

Query: 64  ISVSIGATVGRIRAIILEHTLSIPTAVDEMEKKELRTSATETGL 195
           +   +G+ + +++AII + T+ I    DE+E+ + RT+   + L
Sbjct: 5   VDTLVGSCINKLQAIITDKTILILGVKDELEELQRRTNVIRSSL 48


>11_06_0698 + 26385989-26389090
          Length = 1033

 Score = 29.9 bits (64), Expect = 2.3
 Identities = 12/44 (27%), Positives = 26/44 (59%)
 Frame = +1

Query: 64  ISVSIGATVGRIRAIILEHTLSIPTAVDEMEKKELRTSATETGL 195
           +   +G+ + +++AII + T+ I    DE+E+ + RT+   + L
Sbjct: 5   VDTLVGSCINKLQAIITDKTILILGVKDELEELQRRTNVIRSSL 48


>09_05_0005 +
           20026190-20026343,20026483-20026682,20026918-20027309,
           20027646-20027778,20027858-20027942,20028216-20028235
          Length = 327

 Score = 29.5 bits (63), Expect = 3.0
 Identities = 21/90 (23%), Positives = 36/90 (40%)
 Frame = -3

Query: 389 PAHTWRFLKSVGIGKTPVSSVKDTDLCALNKHFSLPPVSLSDSSKTATLLKISSLSVPRI 210
           P++ + FL   G G  P+S   DTD    N+     P       +  + L +     P +
Sbjct: 25  PSYAYLFLLFKGPGLLPLSHAPDTDSHGFNEGLPGQPPLWEGYRRLQSDLNV-GFPQPNL 83

Query: 209 PIFELSPVSVADVRNSFFSISSTAVGIDNV 120
            +  L+PV +  V     S   + +  DN+
Sbjct: 84  QMLPLAPVKLEPVTEEHQSRGKSVIIADNL 113


>12_01_0038 - 312152-312748,312930-313362,313572-314440,314535-314584,
            314589-315192,315674-315718,316100-316317,317020-317332,
            318681-318716
          Length = 1054

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 15/44 (34%), Positives = 19/44 (43%)
 Frame = -3

Query: 671  HNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTL 540
            H + D  N+F    I LF    PV    IKH+   W   D  T+
Sbjct: 922  HKVEDYRNTFANLAIPLFSMAEPVPPKTIKHQDMAWTVWDRWTI 965


>11_01_0039 - 290960-291086,291615-291714,291809-292013,292466-292513,
            295071-295646,295828-296260,296470-297338,297433-298227,
            298709-298753,299135-299352,300055-300364,302715-302984
          Length = 1331

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 15/44 (34%), Positives = 19/44 (43%)
 Frame = -3

Query: 671  HNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWLTPDIKTL 540
            H + D  N+F    I LF    PV    IKH+   W   D  T+
Sbjct: 1046 HKVEDYRNTFANLAIPLFSMAEPVPPKTIKHQDMAWTVWDRWTI 1089


>10_08_0513 +
           18460095-18460170,18460362-18460441,18461029-18461491,
           18461914-18462073,18462177-18462451,18462634-18462801,
           18463012-18463064
          Length = 424

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 11/31 (35%), Positives = 22/31 (70%), Gaps = 2/31 (6%)
 Frame = -3

Query: 707 VNNTDWSCILEHHNINDM--VNSFNYKVISL 621
           +N T+W+ ++++H I D+  ++ FNYK I +
Sbjct: 318 MNFTEWNLVVQYHPILDITQISGFNYKSIQV 348


>11_04_0374 + 16923063-16923176,16923214-16923363,16923547-16924101
          Length = 272

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 17/63 (26%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = -3

Query: 320 TDLCALNKHFSLPPVSLSDSSKTATLLKISSL--SVPRIPIFELSPVSVADVRNSFFSIS 147
           T+LC+  +  ++P    S S+   + + ++ L  +   +  +  SP+SVAD ++S  SI+
Sbjct: 87  TELCSSEQKVAIP-TKCSTSTLATSAMPLTDLVGTDTSLISYTSSPISVADAQSSIKSIA 145

Query: 146 STA 138
           +T+
Sbjct: 146 ATS 148


>03_03_0266 - 16014740-16015045,16015566-16015601,16015623-16015643,
            16016331-16016591,16017504-16018985,16019834-16019989,
            16020154-16020277,16020399-16020615,16020877-16021774,
            16022947-16023291,16023371-16023565,16023751-16024453,
            16024866-16025467
          Length = 1781

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 11/40 (27%), Positives = 18/40 (45%)
 Frame = -3

Query: 680  LEHHNINDMVNSFNYKVISLFDQHAPVRRVRIKHKPAPWL 561
            L  +    MV  F Y  I++   H P  ++   H+P  W+
Sbjct: 983  LRFYGFGKMVACFRYAPINVHSIHVPPYKLDFSHQPLDWI 1022


>01_01_0463 -
           3424951-3425065,3425191-3425258,3425362-3425586,
           3425669-3425804,3425905-3426107,3426227-3426340,
           3426432-3426506,3426625-3426783,3426868-3427038,
           3427227-3427274,3427366-3427491,3427611-3427718,
           3427800-3427913,3428320-3428496
          Length = 612

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 17/63 (26%), Positives = 29/63 (46%)
 Frame = -3

Query: 221 VPRIPIFELSPVSVADVRNSFFSISSTAVGIDNVCSKMIALILPTVAPILTDIFNFSFTS 42
           +PR P  E SP+ +  +R S  S  +  +G D + ++ + L L +      D+      S
Sbjct: 319 LPRPPAVEPSPILLRGIRQSLLSHLTLVLGKDELAAQCLLLHLLSRLRNKVDVVTVGRLS 378

Query: 41  SNF 33
            NF
Sbjct: 379 LNF 381


>02_01_0632 + 4740052-4740969,4742383-4743009
          Length = 514

 Score = 28.3 bits (60), Expect = 6.9
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = +1

Query: 67  SVSIGATVGRIRAIILEHTLSIPTAVDEMEKKELRTSATETGLNSKIGIRGTDRLEILSN 246
           S+ +  T+G I+A+ILE    +  A  E     L  + TE  +N K+ ++  D    LSN
Sbjct: 291 SLQVPLTMGNIKAVILE----LFGAGSETSASTLHWAMTELIMNPKVMLKAQDE---LSN 343

Query: 247 VAVFDESLSD 276
           V    +++S+
Sbjct: 344 VIKGKQTISE 353


>10_01_0075 -
           979335-979954,980136-980405,980949-980989,981563-981663
          Length = 343

 Score = 27.9 bits (59), Expect = 9.2
 Identities = 14/38 (36%), Positives = 20/38 (52%)
 Frame = +3

Query: 45  GKGKIENIGKYRCYRWKN*GNHFRAYVINSNSRG*DGE 158
           G+G +E  G+ R +RWK    H  AY+   + R   GE
Sbjct: 16  GEGGVEVEGEGRKWRWKGRHQHGSAYISGPDRRFGGGE 53


>01_01_0827 +
           6443319-6446085,6446317-6446407,6446502-6448017,
           6448164-6448243,6449045-6449129,6449221-6449312,
           6449388-6449456,6449544-6449580,6449662-6449744,
           6450427-6450873,6450978-6451014,6451101-6451158,
           6451243-6451382,6451610-6451675,6451794-6451908,
           6453261-6453299,6453482-6453543
          Length = 1927

 Score = 27.9 bits (59), Expect = 9.2
 Identities = 18/64 (28%), Positives = 31/64 (48%), Gaps = 4/64 (6%)
 Frame = +1

Query: 121 TLSIPTAVDEMEKKELRTSAT----ETGLNSKIGIRGTDRLEILSNVAVFDESLSDTGGR 288
           ++ IP+  D   + + RTSA     +   NS +   GT  +E +SN A   E +  + G 
Sbjct: 21  SIPIPSQFDTSIETQTRTSAVVSSEKESANSFVPHNGTGLVERISNDAGLTEVVGSSAGP 80

Query: 289 EKCL 300
            +C+
Sbjct: 81  TECI 84


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,381,832
Number of Sequences: 37544
Number of extensions: 413810
Number of successful extensions: 979
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 954
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 978
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2004270760
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).