SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0034
         (840 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_05_0132 - 22611030-22611908,22612016-22612135,22612644-226128...    31   0.86 
02_05_1006 + 33448476-33448915,33449016-33449083,33449681-334497...    31   1.1  
02_02_0371 - 9513742-9514293,9514784-9514923,9515217-9515556,951...    31   1.5  
11_05_0077 - 18866707-18867334,18867410-18867555                       30   2.6  
10_08_1019 - 22299800-22299946,22300040-22300109,22300930-223010...    30   2.6  
02_01_0399 - 2905026-2905406,2905522-2905630,2905809-2907475,290...    30   2.6  
06_03_0606 - 22689935-22689998,22690716-22691159,22691669-226920...    29   3.5  
07_03_0845 - 21979581-21981281                                         29   4.6  
02_02_0347 + 9222556-9222927                                           29   4.6  
09_04_0460 - 17779111-17780184                                         29   6.1  
09_02_0158 - 5102148-5103818                                           29   6.1  
07_01_0975 + 8223269-8224354                                           29   6.1  
03_01_0130 - 1007433-1007712,1007739-1007803,1007804-1008001,100...    29   6.1  
02_05_1113 + 34207997-34208380                                         29   6.1  
07_01_0947 + 7982783-7983619,7983713-7983859,7983953-7984318           28   8.1  
03_06_0754 - 36025579-36027000                                         28   8.1  
01_01_0728 + 5684699-5685025                                           28   8.1  

>05_05_0132 -
           22611030-22611908,22612016-22612135,22612644-22612856,
           22612968-22613288,22613421-22613504
          Length = 538

 Score = 31.5 bits (68), Expect = 0.86
 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 2/59 (3%)
 Frame = -3

Query: 205 IPGKG-GRPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQPRVLRLHN-PAV 35
           +P  G G     PH EP   A  E    RG  R P   G +R+ RR+P +   H+ PAV
Sbjct: 356 VPEVGDGDDRPAPHDEPAAGAAAELRAARGGERQP---GPRREGRRRPPLAAAHDEPAV 411


>02_05_1006 +
           33448476-33448915,33449016-33449083,33449681-33449751,
           33449905-33450156,33450473-33450636,33450731-33450773,
           33451044-33451161,33451384-33451481,33451550-33451594
          Length = 432

 Score = 31.1 bits (67), Expect = 1.1
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = -3

Query: 199 GKGGRPTAVPHREPGVPAGTEAGRERGLIRGPP 101
           G+G RP +   + P  P G    R RG+ R PP
Sbjct: 31  GRGRRPASAMGQAPSSPPGPGRSRSRGISRWPP 63


>02_02_0371 -
           9513742-9514293,9514784-9514923,9515217-9515556,
           9515659-9515721,9515812-9515910,9516016-9516126,
           9517114-9517257
          Length = 482

 Score = 30.7 bits (66), Expect = 1.5
 Identities = 16/51 (31%), Positives = 23/51 (45%)
 Frame = -3

Query: 175 VPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQPRVLRLHNPAVAVTP 23
           VP  + G P   +A    GL R     G QR  +  P ++   NP ++ TP
Sbjct: 3   VPGSQNGRPRPAKAETIHGLARAGDLAGVQRKLQENPALINDRNPVMSQTP 53


>11_05_0077 - 18866707-18867334,18867410-18867555
          Length = 257

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 22/60 (36%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = -3

Query: 199 GKGGRPTAVPHREPGV-PAGTEAGRERGLIRGPPCVGEQRDSRRQPRVLRLHNPAVAVTP 23
           G GG    V  R  G   A  +A   RG     P VG +R +R  PR+L  H P V + P
Sbjct: 38  GGGGGEAGVRRRTRGTWCAAPDAVAHRG---EDPGVGARRGARAGPRLLPPHRPPVPLRP 94


>10_08_1019 -
           22299800-22299946,22300040-22300109,22300930-22301066,
           22301142-22301195,22301638-22301694,22301814-22301846,
           22301942-22302067,22302162-22302815,22303042-22303166,
           22303770-22303935
          Length = 522

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 1/40 (2%)
 Frame = +3

Query: 51  SRSTRGCRRLS-RCSPTQGGPRMSPRSRPASVPAGTPGSR 167
           S+   G  RL   C P  G P   PR+ P+SVP   P  R
Sbjct: 141 SQLVLGLHRLGFACIPRSGAPLTRPRTAPSSVPHQPPPRR 180


>02_01_0399 - 2905026-2905406,2905522-2905630,2905809-2907475,
            2907650-2907790,2907870-2908043,2908577-2908851,
            2909592-2909755,2910409-2910536,2910628-2910734,
            2911747-2911880,2912266-2912441,2912530-2914257,
            2915084-2915239,2915328-2915486,2915581-2915751,
            2915931-2916047,2916417-2916473,2916565-2916680,
            2916790-2916916,2917862-2917945
          Length = 2056

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 21/105 (20%), Positives = 43/105 (40%)
 Frame = -1

Query: 417  DRLTWGDGKDYTSHHVSWQLISLWEDNNVIFKILNTEYEMYLKLDVNVDSYGDRKTWGSN 238
            D+ +WG+     S   +W    + + N       +  ++ +    V+  +  D+++WG+ 
Sbjct: 1729 DKESWGNVPASPSDS-AWNAAPVSQGNESSDAKQSDSWDGWKSAGVDASTNKDKESWGNV 1787

Query: 237  GSSEKRHTWSLYPVKVGDQQLFLIENREYRQGLKLDANVDSYGDR 103
             +S     W+  PV  GD    +  + E  +    D   D +G R
Sbjct: 1788 PASPSDSAWNAAPVSQGDD---VWNSAEANESRNKDWKSDGWGAR 1829



 Score = 28.7 bits (61), Expect = 6.1
 Identities = 13/62 (20%), Positives = 28/62 (45%)
 Frame = -1

Query: 273  DSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQLFLIENREYRQGLKLDANVDSYGDRLVW 94
            DS  D+++WG+  +S     W+  PV  G++     ++  +        +  +  D+  W
Sbjct: 1725 DSVKDKESWGNVPASPSDSAWNAAPVSQGNESSDAKQSDSWDGWKSAGVDASTNKDKESW 1784

Query: 93   GS 88
            G+
Sbjct: 1785 GN 1786


>06_03_0606 - 22689935-22689998,22690716-22691159,22691669-22692057,
            22692130-22692223,22692507-22692599,22692705-22692913,
            22692999-22693833,22693948-22694038,22698069-22698892,
            22699384-22700489,22701353-22701415
          Length = 1403

 Score = 29.5 bits (63), Expect = 3.5
 Identities = 15/48 (31%), Positives = 20/48 (41%)
 Frame = -3

Query: 208  FIPGKGGRPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQP 65
            F  G+ G P  +  R  G PA         ++RG    G +R   RQP
Sbjct: 1291 FNGGRRGAPATLAPRSGGAPAVARRQNRAKILRGEKVGGARRGGARQP 1338


>07_03_0845 - 21979581-21981281
          Length = 566

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 8/53 (15%)
 Frame = -1

Query: 456 QALKLDANVGEYNDRLTWGDGKDYT----SHHVSW----QLISLWEDNNVIFK 322
           Q   ++   GEY DR++W D +D      S+HV      Q +SLW  + V ++
Sbjct: 167 QRFGINKITGEYQDRVSWKDPEDPAPGPFSNHVDLIRLNQYVSLWNQSKVYWQ 219


>02_02_0347 + 9222556-9222927
          Length = 123

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 16/43 (37%), Positives = 19/43 (44%)
 Frame = -3

Query: 193 GGRPTAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRDSRRQP 65
           GGR    P R    P  T +  E   +    C GEQR  RR+P
Sbjct: 49  GGRAGREPQRRRPPPPWTRSAAEAVAVGKGHCQGEQRRWRRRP 91


>09_04_0460 - 17779111-17780184
          Length = 357

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 12/45 (26%), Positives = 19/45 (42%)
 Frame = -1

Query: 273 DSYGDRKTWGSNGSSEKRHTWSLYPVKVGDQQLFLIENREYRQGL 139
           D +GD       G  +  H W +  V + +  +  I   EYR G+
Sbjct: 107 DGFGDGDEEAGGGGGDVHHVWYIRTVGLDEATITSIATAEYRAGV 151


>09_02_0158 - 5102148-5103818
          Length = 556

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -3

Query: 181 TAVPHREPGVPAGTEAGRERGLIRGPPCVGEQRD 80
           T  P   PG P    AG ERG +R PP     +D
Sbjct: 80  TTSPAHGPGQPPLDSAGGERGQLRRPPTPETDKD 113


>07_01_0975 + 8223269-8224354
          Length = 361

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 11/23 (47%), Positives = 15/23 (65%)
 Frame = +3

Query: 96  TQGGPRMSPRSRPASVPAGTPGS 164
           + G P  SP S P+S P+G+P S
Sbjct: 240 SSGSPSSSPSSSPSSSPSGSPSS 262


>03_01_0130 - 1007433-1007712,1007739-1007803,1007804-1008001,
            1008103-1008273,1008405-1008553,1008780-1008927,
            1009015-1009083,1009168-1009416,1009516-1009710,
            1009869-1009985,1010205-1011329
          Length = 921

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 23/92 (25%), Positives = 38/92 (41%), Gaps = 1/92 (1%)
 Frame = -1

Query: 462  YNQALKLDANVGEYNDRLTWGDGKDYTSHHVSWQLISLWEDN-NVIFKILNTEYEMYLKL 286
            Y  A  L A  G+ ND L   +  D+T   + W  +SLW ++   + +  +    +    
Sbjct: 795  YTWANMLSAPRGQVNDPLITQNSTDFTVALMDWFWMSLWAEHIGAVEESFSCPESLECTR 854

Query: 285  DVNVDSYGDRKTWGSNGSSEKRHTWSLYPVKV 190
             V      + + + S+  SE R     YPV V
Sbjct: 855  QVRHIGEQNWRQFASSEVSEMRGHLVKYPVSV 886


>02_05_1113 + 34207997-34208380
          Length = 127

 Score = 28.7 bits (61), Expect = 6.1
 Identities = 14/31 (45%), Positives = 16/31 (51%)
 Frame = -3

Query: 805 WSRVRTARRLEDPDGIQHEDGLCRRNVNQQP 713
           W R RTARR    DG   E+G C R   + P
Sbjct: 45  WRRSRTARRTPVADGDGSEEGGCGRGRRRGP 75


>07_01_0947 + 7982783-7983619,7983713-7983859,7983953-7984318
          Length = 449

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 15/29 (51%), Positives = 16/29 (55%)
 Frame = +3

Query: 12  GI*KGVTATAGL*SRSTRGCRRLSRCSPT 98
           G+  G  A   L  R  RGCRRLS  SPT
Sbjct: 186 GVLAGCAALDCLLLRGVRGCRRLSISSPT 214


>03_06_0754 - 36025579-36027000
          Length = 473

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 13/39 (33%), Positives = 20/39 (51%)
 Frame = -3

Query: 391 RLHQPPCQLATHLSLGRQQRDIQDTEHRIRDVLETGRER 275
           R H+   Q+A   +L     D+ D EH +R +L+T   R
Sbjct: 145 RAHKMDKQVAATSALRTAMEDLADAEHGLRKLLQTSSSR 183


>01_01_0728 + 5684699-5685025
          Length = 108

 Score = 28.3 bits (60), Expect = 8.1
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 3/61 (4%)
 Frame = +3

Query: 33  ATAGL*SRSTRGCRRLSRCSPTQGG---PRMSPRSRPASVPAGTPGSR*GTAVGLPPLPG 203
           ++AG  + +  G R  +  SP +     PR  P   P S PA T G+R    +G  P PG
Sbjct: 48  SSAGAAAAAVAGRRSTASSSPPEEEMLLPRRPPL--PLSPPAATTGARSSRMLGSVPSPG 105

Query: 204 I 206
           +
Sbjct: 106 V 106


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,158,445
Number of Sequences: 37544
Number of extensions: 470848
Number of successful extensions: 1633
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1557
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1632
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2326952232
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).