SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0033
         (887 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_03_0512 + 14913356-14913769,14915907-14916032,14916129-149161...   147   1e-35
06_01_0314 + 2255908-2255979,2256354-2256512,2257021-2257209,225...   106   2e-23
06_01_0109 - 863806-864045,864448-864566,864680-864851,864914-86...    75   6e-14
12_02_0659 - 21612325-21612328,21613164-21613199,21613279-216133...    30   2.1  
01_06_0405 + 29103723-29103839,29103928-29104012,29104572-291046...    30   2.8  
06_01_0286 - 2094920-2097805                                           29   3.7  
12_01_0485 - 3848721-3849227,3852019-3852369                           29   6.5  
05_01_0355 - 2774217-2774318,2774608-2774775,2774872-2775090,277...    29   6.5  

>05_03_0512 +
           14913356-14913769,14915907-14916032,14916129-14916185,
           14916950-14917027,14917681-14917773
          Length = 255

 Score =  147 bits (356), Expect = 1e-35
 Identities = 94/235 (40%), Positives = 120/235 (51%), Gaps = 31/235 (13%)
 Frame = +3

Query: 120 IRVAGASRQKHT--LPELPYEYNALEPVISREIMSLHHSKHH----ATYINNLNVAEEKL 281
           +  A A+R   T  LP+LPY+Y ALEP IS EIM LHH KHH    A Y   L   +  +
Sbjct: 19  LAAAAAARGVTTVALPDLPYDYGALEPAISGEIMRLHHQKHHATYVANYNKALEQLDAAV 78

Query: 282 AQAQAKG--DIDTIINL--------APALKFNGGGHINHSIFW------------HNLSP 395
           A+  A     + + I           P   F   G ++   F               L  
Sbjct: 79  AKGDAPAIVHLQSAIKFNGGGEAKSRPPYPFLAYGFLSFFFFVLFIAGDAGGGGSEELGG 138

Query: 396 NGG--KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQN 569
            GG   P   L  A+++DFGS++ +  ++S    A+QGSGW WL  +K+ KKL + T  N
Sbjct: 139 EGGGDPPHAKLGWAIDEDFGSFEALVKKMSAEGAALQGSGWVWLALDKEAKKLSVETTAN 198

Query: 570 QDPLQAT-TGLVPLFGIDVWEHAYYLQYKNVRADYVKAIFDVANWNDISQRYEKA 731
           QDPL      LVPL GIDVWEHAYYLQYKNVR DY+  I+ V NW    + YE A
Sbjct: 199 QDPLVTKGANLVPLLGIDVWEHAYYLQYKNVRPDYLSNIWKVMNWKYAGEVYENA 253


>06_01_0314 +
           2255908-2255979,2256354-2256512,2257021-2257209,
           2257390-2257561,2257711-2257784,2257818-2257904,
           2257975-2257998,2258100-2258225
          Length = 300

 Score =  106 bits (255), Expect = 2e-23
 Identities = 66/217 (30%), Positives = 109/217 (50%), Gaps = 28/217 (12%)
 Frame = +3

Query: 165 LPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKG-DIDTIINLA---- 329
           L +  +ALEP IS+  + LH  KH   Y+++LN   ++LA +   G  ++ +I  A    
Sbjct: 73  LVFTTDALEPYISKRTVELHWGKHQQDYVDSLN---KQLATSMFYGYTLEELIKEAYNNG 129

Query: 330 -PALKFNGGGHI-NHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQ 500
            P  ++N    + NH  FW ++ P GG  P   + + +EKDFGS+ N + +   +++++ 
Sbjct: 130 NPLPEYNNAAQVWNHHFFWESMQPEGGGSPGRGVLQQIEKDFGSFTNFREEFIRSALSLL 189

Query: 501 GSGWGWLGYNKQMKKLQIATCQNQ-------------------DPLQATTGLVPLFGIDV 623
           GSGW WL   ++ +K  +   QN                    D +     L PL  +D+
Sbjct: 190 GSGWVWLVLKRKERKFSVVHTQNAISPLALGDINNSIPSINLCDDIPCPLLLQPLINLDL 249

Query: 624 WEHAYYLQYKNVRADYVKAIFD-VANWNDISQRYEKA 731
           WEHAYYL YK+ R  YV    D + +W+ ++ R  +A
Sbjct: 250 WEHAYYLDYKDDRRMYVTNFIDHLVSWDTVTLRMMRA 286


>06_01_0109 -
           863806-864045,864448-864566,864680-864851,864914-865108,
           865179-865388,865738-865926
          Length = 374

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 56/199 (28%), Positives = 92/199 (46%), Gaps = 9/199 (4%)
 Frame = +3

Query: 165 LPYEYNALEPVISREIMSLHHSKHHATYINNLNV----AE-EKLAQAQAKGDIDTIINLA 329
           LPY  +ALEP IS+E +  H   H   ++  LN     +E E ++  Q           A
Sbjct: 129 LPYPSDALEPYISKETVEQHWGVHQNIHVERLNGMIGGSEWEGMSLGQMMLSSFNEGREA 188

Query: 330 PALKFNGGGHI-NHSIFWHNLSPNGG-KPSDVLTKAVEKDFGSWDNIKNQLSTASVAVQG 503
           P   F     I NH  +W ++ P GG KP + L K + +DFGS+D +  Q   A+    G
Sbjct: 189 PHPPFFHAAQIWNHDFYWRSMQPGGGGKPPERLLKFINRDFGSYDGMIRQFMDAASTQFG 248

Query: 504 SGWGWLGYNKQMKKLQIATCQNQDPLQATT-GLVPLFGIDVWEHAYYLQYKNVRADYVKA 680
           SGW WL Y    K  ++   +++ P+ +   G + +       +     + + R+DYV  
Sbjct: 249 SGWVWLCY----KTSKLPHVKSRSPIPSDNYGRLVISKSPNAINPLVWGHSDRRSDYVST 304

Query: 681 IFD-VANWNDISQRYEKAL 734
             + + +W  +  R +KA+
Sbjct: 305 FLEKLVSWETVESRLKKAV 323


>12_02_0659 -
           21612325-21612328,21613164-21613199,21613279-21613394,
           21613983-21614567
          Length = 246

 Score = 30.3 bits (65), Expect = 2.1
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = -1

Query: 632 VLPYIDSEERDQSSGGLQRILVLACSYLQFLH 537
           + PY + EE D +SG  ++  VL C +LQF H
Sbjct: 53  IFPYYEHEEIDSASGEKKK--VLPCYFLQFQH 82


>01_06_0405 +
           29103723-29103839,29103928-29104012,29104572-29104674,
           29104798-29104882,29105414-29105497,29105627-29105730,
           29106522-29106783,29106978-29107414,29107637-29107718,
           29109913-29110089,29110640-29110732,29110812-29110877,
           29110992-29111038,29111165-29111430,29111443-29111845,
           29111992-29112376
          Length = 931

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 17/45 (37%), Positives = 23/45 (51%)
 Frame = -1

Query: 329 CKVDNGVDITFSLCLCEFLFSNV*IVDISRVMFAVMKTHDFTAND 195
           C VD  V + +    CEF    V + DISR++F   K  +F  ND
Sbjct: 108 CTVDGHVKL-YRSPFCEFCDEWVEVADISRLLFKFYKGIEFGEND 151


>06_01_0286 - 2094920-2097805
          Length = 961

 Score = 29.5 bits (63), Expect = 3.7
 Identities = 18/56 (32%), Positives = 25/56 (44%)
 Frame = +3

Query: 153 TLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVAEEKLAQAQAKGDIDTII 320
           +L  L   +N L  +I   + SLH   H     NNL+    + +Q Q  GD D  I
Sbjct: 807 SLESLDLSWNRLSGIIPESMTSLHLLSHLNMSYNNLSGMVPQGSQLQTLGDEDPYI 862


>12_01_0485 - 3848721-3849227,3852019-3852369
          Length = 285

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%)
 Frame = +2

Query: 518 AWLQQTNEEIANSYMPEPGSSAGHH-WIGPALR 613
           AW     E I  +    PG+ AG+H W+GP  R
Sbjct: 134 AWKSWLEEHITATGKAPPGNVAGNHTWVGPPQR 166


>05_01_0355 -
           2774217-2774318,2774608-2774775,2774872-2775090,
           2775176-2775319,2775485-2775767,2775874-2775929,
           2776012-2776161,2776254-2776340,2776414-2776449,
           2777100-2777162,2777247-2777327,2777407-2777496,
           2777690-2777767,2777855-2778058,2778139-2778186,
           2778262-2778447,2779879-2779978,2780121-2780260
          Length = 744

 Score = 28.7 bits (61), Expect = 6.5
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = -1

Query: 773 LNWFNRFF*NYSLERFFISLRYIIPV 696
           + W +RFF  + L+R+FIS R +IP+
Sbjct: 108 VRWLSRFF--FYLDRYFISRRSLIPL 131


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,279,936
Number of Sequences: 37544
Number of extensions: 525052
Number of successful extensions: 1419
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1365
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1414
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2495239620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).