SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0031
         (644 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_04_1208 - 31750493-31750587,31750733-31750851,31751425-317514...   152   2e-37
07_03_0566 - 19572410-19572504,19572590-19572708,19573109-195731...   149   2e-36
08_01_0609 + 5345761-5345862,5346808-5346871,5346958-5350191,535...    94   7e-20
11_01_0001 - 336-427,515-576,704-756,974-1249,1496-1834                60   1e-09
02_04_0068 - 19442643-19442734,19442824-19442885,19443013-194430...    60   2e-09
05_04_0295 + 19940822-19940906,19940976-19941902,19941956-19942866     33   0.26 
09_06_0199 + 21526872-21527250,21527431-21527594,21527673-215277...    29   2.4  
07_03_0039 - 12718972-12720699                                         29   2.4  
02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-52...    28   5.5  
09_02_0475 + 9724676-9724936,9725518-9726216,9726273-9726596,972...    28   7.3  
04_01_0530 - 6928528-6929500,6929514-6930964                           28   7.3  
05_01_0166 + 1145829-1145971,1146211-1146235,1147330-1147425,114...    27   9.7  

>04_04_1208 -
           31750493-31750587,31750733-31750851,31751425-31751477,
           31751567-31751622,31752690-31752726
          Length = 119

 Score =  152 bits (369), Expect = 2e-37
 Identities = 65/115 (56%), Positives = 90/115 (78%)
 Frame = +2

Query: 47  KFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFY 226
           K  +K +H+ E+R+AE  +IR KY DR+PVIVEKA ++ + D+DKKKYLVP+DLTVGQF 
Sbjct: 3   KSSFKLDHTLERRQAEANRIREKYSDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFV 62

Query: 227 FLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 391
           +++RKRI L PE A+F FV N +PPT+A M ++Y+E+ DED FLY+ +S EN +G
Sbjct: 63  YVVRKRIKLSPEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYMTYSGENTFG 117


>07_03_0566 -
           19572410-19572504,19572590-19572708,19573109-19573161,
           19573251-19573306,19574297-19574340,19576767-19576816,
           19577393-19577398,19577675-19578103
          Length = 283

 Score =  149 bits (360), Expect = 2e-36
 Identities = 64/113 (56%), Positives = 88/113 (77%)
 Frame = +2

Query: 56  YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLI 235
           +K EH  E+R+AE  +IR KY DR+PVIVEKA K  + ++DKKKYLVP+DLTVGQF +++
Sbjct: 170 FKLEHPLERRQAESARIREKYSDRIPVIVEKADKTDVPEIDKKKYLVPADLTVGQFVYVV 229

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 394
           RKRI L PE A+F FV N +PPT++ M ++Y+E+ DED FLY+ +S EN +G+
Sbjct: 230 RKRIKLSPEKAIFVFVKNTLPPTASLMSAIYEENKDEDGFLYMTYSGENTFGS 282


>08_01_0609 + 5345761-5345862,5346808-5346871,5346958-5350191,
            5350375-5350589,5351123-5351393,5351986-5352161,
            5352287-5352394,5352821-5352930,5354291-5354393,
            5354658-5354828,5354952-5355080,5355322-5355504,
            5355612-5355701,5355823-5355934,5356100-5356227,
            5357769-5357825,5357872-5357923,5358318-5358393,
            5358860-5358950,5359046-5359224,5359563-5359681,
            5359783-5359880
          Length = 1955

 Score = 94.3 bits (224), Expect = 7e-20
 Identities = 39/69 (56%), Positives = 54/69 (78%)
 Frame = +2

Query: 185  KYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYI 364
            +YLVP+DLTVGQF +++RKRI L  E A+F FV N +PPT+A M ++Y+E+ DED FLY+
Sbjct: 1884 RYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNTLPPTAALMSAIYEENKDEDGFLYM 1943

Query: 365  AFSDENVYG 391
             +S EN +G
Sbjct: 1944 TYSGENTFG 1952



 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 23/37 (62%), Positives = 31/37 (83%)
 Frame = +2

Query: 77   EKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKK 187
            E+R+AE  +IR KYPDR+PVIVEKA ++ + D+DKKK
Sbjct: 1806 ERRQAEANRIREKYPDRIPVIVEKAERSDIPDIDKKK 1842


>11_01_0001 - 336-427,515-576,704-756,974-1249,1496-1834
          Length = 273

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 39/104 (37%), Positives = 57/104 (54%), Gaps = 1/104 (0%)
 Frame = +2

Query: 83  RKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRPE 262
           R+ EGE+ RR    +  VIVEK  ++ L +++K+K                   +HL P 
Sbjct: 192 REEEGERERR---GKGQVIVEKFSRSNLPEMEKRK-------------------LHLSPG 229

Query: 263 DALFFFVNNVIPPTSATMGSLYQEHHDE-DFFLYIAFSDENVYG 391
            ALF FVNN +P T+  MGS+Y+ + DE D FLY+ +S E  +G
Sbjct: 230 TALFVFVNNTLPQTAQLMGSVYESYKDEGDGFLYLCYSSEKTFG 273


>02_04_0068 -
           19442643-19442734,19442824-19442885,19443013-19443067,
           19443290-19443344
          Length = 87

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 25/53 (47%), Positives = 37/53 (69%), Gaps = 1/53 (1%)
 Frame = +2

Query: 236 RKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDE-DFFLYIAFSDENVYG 391
           ++++HL P  ALF FVNN +P T+  MGS+Y+ + DE D FLY+ +S E  +G
Sbjct: 35  KRKLHLPPGTALFVFVNNTLPQTAQLMGSVYESYKDEGDGFLYLCYSSEKTFG 87


>05_04_0295 + 19940822-19940906,19940976-19941902,19941956-19942866
          Length = 640

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 13/29 (44%), Positives = 21/29 (72%), Gaps = 1/29 (3%)
 Frame = +3

Query: 480 YYFMVFFLLLIGI*YYF-CLHMNSIKLFK 563
           YY++V FLL++ + YYF C H  ++K F+
Sbjct: 576 YYWLVTFLLVLNLAYYFVCFHFYTLKSFE 604


>09_06_0199 +
           21526872-21527250,21527431-21527594,21527673-21527736,
           21528001-21528134,21528302-21528385,21528526-21528600,
           21528683-21528754,21528852-21528925,21529185-21529282,
           21529355-21529464,21529794-21529862,21529944-21530018,
           21530519-21530611,21530690-21530769,21530877-21530976,
           21531150-21531586,21531676-21531706,21532873-21533822,
           21533982-21534201
          Length = 1102

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +2

Query: 59  KEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLV 196
           KEE + EK++    KI++  P R     EK P    G   K+ ++V
Sbjct: 654 KEEPTSEKKQPVSAKIKKTVPKRTSGTKEKKPDTDQGGKRKRNWMV 699


>07_03_0039 - 12718972-12720699
          Length = 575

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +2

Query: 194 VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNV-IPPTS 307
           VPS L    F  L+R+ +   P + L FF+ ++ +PPT+
Sbjct: 80  VPSSLRTSAFPSLLRRHLAFHPLNELPFFLESIGLPPTT 118


>02_01_0075 - 522554-522616,522742-522748,523033-523136,523237-523368,
            525209-525401,525978-526330,526693-526791,526864-526935,
            527062-527213,527338-527386,527755-527885,528067-528307,
            528392-528565,528656-528797,529236-529282,529370-529450,
            530170-530271,530345-530440,531437-531444,531575-531616,
            531830-531894,534761-534853,534888-534959,535303-535509,
            536318-537226,537503-538158
          Length = 1429

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 6/43 (13%)
 Frame = +1

Query: 346  RFLFIHSIFRRKCLW------KLIPNYSLSNSFTLSDHMVKFN 456
            RF+F+ S++  +  +      KLI N+SL+ +  + DH + FN
Sbjct: 1350 RFVFLDSLYDEESFYHAELRPKLISNFSLAWNLYVQDHSIDFN 1392


>09_02_0475 +
           9724676-9724936,9725518-9726216,9726273-9726596,
           9726900-9727847
          Length = 743

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +1

Query: 385 LWKLIPNYSLSNSFTLSDHMVKFNLSLRLKLCII 486
           LW+L+  +SL      S   + +++SL LK C +
Sbjct: 335 LWELVERHSLEREVFSSFKQIYYDMSLMLKSCFL 368


>04_01_0530 - 6928528-6929500,6929514-6930964
          Length = 807

 Score = 27.9 bits (59), Expect = 7.3
 Identities = 12/42 (28%), Positives = 23/42 (54%)
 Frame = -1

Query: 371 KMLCIKRNLHHGVLDRETPLLQMWVE*HCSRRRKVRLQAAGE 246
           +++C ++N+   VLD E  +L  W    C +  ++ L  AG+
Sbjct: 709 ELVCCRKNVELEVLDEEQTILTYWAN-DCYKCGRIDLLVAGD 749


>05_01_0166 + 1145829-1145971,1146211-1146235,1147330-1147425,
            1147544-1147645,1147767-1147889,1147996-1148622,
            1148710-1148883,1148965-1149181,1149312-1149394,
            1149478-1149573,1149676-1149724,1149850-1150088,
            1150547-1150618,1150694-1150804,1150930-1151282,
            1151377-1151464,1151691-1151789,1151860-1151991,
            1152119-1152222,1153179-1153215,1153334-1153367,
            1153451-1153467
          Length = 1006

 Score = 27.5 bits (58), Expect = 9.7
 Identities = 12/31 (38%), Positives = 20/31 (64%)
 Frame = +1

Query: 364  SIFRRKCLWKLIPNYSLSNSFTLSDHMVKFN 456
            SI+ ++   KLI N+SL+ +  + DH + FN
Sbjct: 933  SIYHQQIRPKLISNFSLAWNLYVKDHPIDFN 963


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,525,864
Number of Sequences: 37544
Number of extensions: 310310
Number of successful extensions: 788
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 753
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 788
length of database: 14,793,348
effective HSP length: 79
effective length of database: 11,827,372
effective search space used: 1596695220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).