SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0028
         (956 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585     33   0.25 
03_05_0340 + 23294044-23294166,23294395-23294640,23294907-232949...    30   2.4  
01_01_0821 + 6399890-6400397,6400474-6401066                           30   2.4  
05_04_0120 - 18175292-18176206,18177315-18177785,18178562-18179635     30   3.1  
02_01_0061 + 442288-442411,442445-445498,445630-446000                 30   3.1  
12_02_1205 - 26982163-26982702                                         29   5.5  
05_07_0095 - 27659944-27660795,27660900-27661172,27661280-276613...    29   5.5  
04_03_0996 + 21533874-21534469,21534963-21535041                       29   5.5  
02_05_0814 - 31970558-31971126,31971242-31971413                       29   7.2  
06_03_0940 + 26145746-26145879,26146740-26146821,26147349-261474...    28   9.6  
03_01_0184 - 1479520-1479649,1479889-1479938,1480519-1480683,148...    28   9.6  
01_01_0668 - 5109476-5110112,5110196-5110439,5110519-5110917,511...    28   9.6  

>04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585
          Length = 268

 Score = 33.5 bits (73), Expect = 0.25
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = +1

Query: 613 PPC*PRPTYS*CGSAIRLWPRSLSCRPSTCPPEP 714
           PPC     +  CG  IR WP  +   P  CPP P
Sbjct: 221 PPCGCSGGHGNCGCGIRPWPPQVWPPPPVCPPPP 254


>03_05_0340 +
           23294044-23294166,23294395-23294640,23294907-23294945,
           23295439-23295805,23295904-23296136,23296496-23296756
          Length = 422

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = -2

Query: 703 GRSRAGSSMSEARVESLNRISCMLGAVSTA-GPSSSPRDGLSCCSETRQDSWHPLH 539
           G  RAGSS+    V+S + IS     +      SS  R+G+S  SE  +DS  P H
Sbjct: 230 GVDRAGSSLGRTDVKSASEISIKEEPIDQEENVSSRNRNGVSDESEEDEDSEGPAH 285


>01_01_0821 + 6399890-6400397,6400474-6401066
          Length = 366

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 16/59 (27%), Positives = 29/59 (49%)
 Frame = +1

Query: 364 EQTDPTLKA*VCRWMTTSTQLYSWIISGLKRFRHQRSTSSFGLKRYALSWYCTSGTGLY 540
           E++D  ++    RWM    + YSW I   KR++  +  S+F +  +      +SG G +
Sbjct: 39  EKSDKEMRFLFSRWMAQYGKAYSWPIEHEKRYQIWKDNSNF-IGSFRSETEISSGVGAF 96


>05_04_0120 - 18175292-18176206,18177315-18177785,18178562-18179635
          Length = 819

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 38/145 (26%), Positives = 67/145 (46%), Gaps = 3/145 (2%)
 Frame = -2

Query: 457 IVLGPRLSSCIVGSKSSSTGRLRPSMS-DPFAPFITAYNTLKINSKSVCSPSFSSIKY*G 281
           ++L P     I  + SS      P+ S DP +P + A+ +  + S +  SPSFS   +  
Sbjct: 9   LLLSPTSKDLIAAASSSFPSPPSPTTSSDPASP-LDAFASDPVLS-AFLSPSFSPSDF-- 64

Query: 280 PQRTANSAKHSSSDPASGLTVSRWQLVESWAKHAQIHLI--IFPASPGYISTIRSV*SAS 107
                     SS+  +SGL  SR + ++   +  + HL   +    P  +S + S+ SAS
Sbjct: 65  ----------SSAALSSGLAASRAEQLQEAIRLLRRHLRAEVLRRHPLLLSHLLSLRSAS 114

Query: 106 TNMQSLTTLAMFLFFIMSICSKHVT 32
            ++ SL +    L   +S+ S H++
Sbjct: 115 ASLSSLPSHLHLLSSHLSLLSSHLS 139


>02_01_0061 + 442288-442411,442445-445498,445630-446000
          Length = 1182

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 18/48 (37%), Positives = 21/48 (43%)
 Frame = +3

Query: 699 LPARAGTTPGLTTSERQVRVLLRDIGGKACWDASALYFDPSGGQLEGG 842
           +P R GT P L T +     L  DI        S +Y D  G QL GG
Sbjct: 241 IPTRFGTLPELKTLDLSNNALRGDIPPLLGSSPSFVYVDLGGNQLTGG 288


>12_02_1205 - 26982163-26982702
          Length = 179

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 13/30 (43%), Positives = 20/30 (66%), Gaps = 2/30 (6%)
 Frame = +1

Query: 502 ALSWYCTSGTGLYGADANCP--VVFPSNTT 585
           A+S+ C+SG GL   D+ CP   +FPS+ +
Sbjct: 133 AMSFSCSSGVGLTCRDSRCPDAYLFPSDNS 162


>05_07_0095 -
           27659944-27660795,27660900-27661172,27661280-27661354,
           27661683-27661837,27661935-27662051,27662148-27662487
          Length = 603

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 17/40 (42%), Positives = 20/40 (50%)
 Frame = +1

Query: 445 GLKRFRHQRSTSSFGLKRYALSWYCTSGTGLYGADANCPV 564
           GL RFR +RSTSS      ALS   +S   L   D   P+
Sbjct: 11  GLDRFRWRRSTSSSSSSPLALSLSSSSAAALSDDDPGSPM 50


>04_03_0996 + 21533874-21534469,21534963-21535041
          Length = 224

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = -2

Query: 445 PRLSSCIVGSKSSSTGRLRPSMSDPFAPFITA 350
           P +SS    S SSS+     S+S PFAPF  A
Sbjct: 39  PSVSSTSTSSSSSSSSSSSSSLSFPFAPFSPA 70


>02_05_0814 - 31970558-31971126,31971242-31971413
          Length = 246

 Score = 28.7 bits (61), Expect = 7.2
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
 Frame = -3

Query: 348 TTP*KSTAKVFVLHPSLPL-STEVRNVPQTRPSTAAVTRPVV*RCHGGS 205
           TTP  ST      +PS P+ +T   + P T P+T   T P    C GG+
Sbjct: 153 TTPNPSTPTPTTPYPSTPMPTTPYPSTPMTTPTTPYTT-PTSPACSGGA 200


>06_03_0940 +
           26145746-26145879,26146740-26146821,26147349-26147427,
           26147527-26147624,26148392-26148479,26148589-26148686,
           26148881-26148982,26149237-26149281,26150535-26150574,
           26150988-26151074,26151254-26151330,26151746-26151808,
           26152650-26152766,26152905-26153116,26153690-26153785,
           26153869-26153935,26154028-26154081
          Length = 512

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 1/29 (3%)
 Frame = +3

Query: 459 PASTIDVKLWAQTICTQLVLYLGH-WPLW 542
           P +   V+LW+  +   LV Y GH +P+W
Sbjct: 279 PYTLFQVRLWSTKLNANLVCYKGHNYPVW 307


>03_01_0184 -
           1479520-1479649,1479889-1479938,1480519-1480683,
           1481287-1481339,1481805-1481934,1482189-1482266,
           1482583-1482642,1483428-1483480,1483574-1483895
          Length = 346

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = -1

Query: 737 RRQTWCSPGSGGQVEGRQLNERGQSRIAEPHQLY 636
           RR  +C+PG GG+V      E+ +    E  + Y
Sbjct: 44  RRPLYCAPGGGGEVSAPPATEQQEQAAKEEEEEY 77


>01_01_0668 -
           5109476-5110112,5110196-5110439,5110519-5110917,
           5111390-5111668,5111886-5112257,5112371-5112475,
           5112832-5112909,5112990-5113199,5113287-5113406,
           5113508-5113606,5113685-5113750,5113914-5114141,
           5114216-5114521,5115324-5115381
          Length = 1066

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 18/72 (25%), Positives = 31/72 (43%)
 Frame = +3

Query: 417 DPTIQLDNLGPKTIPASTIDVKLWAQTICTQLVLYLGHWPLWSGCQLSCRVSEQHDSPSL 596
           +PTI L   GP T+P    +  +W   +  +++  + + P    C +S   +     P  
Sbjct: 44  EPTIAL---GPVTLPTGCSEFLMWCGIMALKIITSIDNCPY--NCFVSAPSAPSASPPVA 98

Query: 597 GEELGPAVLTAP 632
              + PAV T P
Sbjct: 99  KGAVSPAVPTRP 110


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,143,627
Number of Sequences: 37544
Number of extensions: 610611
Number of successful extensions: 1864
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1783
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1863
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2764678640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).