SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0026
         (744 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

11_04_0201 - 14768341-14768524,14768720-14768838                       29   5.2  
07_03_1762 - 29299328-29299437,29299782-29299871,29300487-293012...    28   6.8  
06_01_0068 - 572964-573323                                             28   6.8  

>11_04_0201 - 14768341-14768524,14768720-14768838
          Length = 100

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = -2

Query: 560 HHLDADGRRPAAGVQEAGERRQRDREED 477
           +H + +GRR AA ++ A  +R   REED
Sbjct: 57  NHQNTEGRRSAAAMRTATRQRDAKREED 84


>07_03_1762 -
           29299328-29299437,29299782-29299871,29300487-29301291,
           29301956-29303278
          Length = 775

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%)
 Frame = +3

Query: 408 RTVVPRLVGQNVRKPSRSWCEN-GIFFSISLTALTSLLYTCCRSPPICIEMMRRWS 572
           RT + R VG+  ++P  +W +  GI  S    A    +  CC +   C   +  WS
Sbjct: 347 RTFLSRRVGEKGKEPEEAWKQTCGICLSEEQRATIQGVLNCC-AHYFCFACIMEWS 401


>06_01_0068 - 572964-573323
          Length = 119

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 1/40 (2%)
 Frame = -2

Query: 530 AAGVQEAGERRQRDRE-EDPVLAPRPARLPHVLPDQPGHH 414
           AAG     ERRQR R+ E+  L   P  L  VL  +  HH
Sbjct: 3   AAGAGRLRERRQRRRQREERQLRDEPLHLRRVLRQRGTHH 42


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,935,709
Number of Sequences: 37544
Number of extensions: 284345
Number of successful extensions: 1233
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1195
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1231
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1968901276
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).