SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0024
         (892 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_03_0108 - 12628711-12629178                                        171   5e-43
05_01_0438 + 3475017-3475484                                          171   6e-43
09_06_0335 + 22391378-22391480,22391580-22391769,22392747-223928...   106   2e-23
09_04_0554 + 18495073-18495175,18495794-18496032                      106   2e-23
09_04_0354 + 16919133-16919235,16920145-16920355,16920478-169205...   106   2e-23
09_04_0148 + 15106392-15106484,15107517-15107776,15107920-15108028    106   2e-23
07_03_0427 - 18080959-18081079,18081203-18081410,18081608-18081710    106   2e-23
06_03_1149 + 28018932-28020529,28020989-28021067                      106   2e-23
06_03_1097 - 27570037-27570262,27570575-27570730,27570763-275708...   106   2e-23
04_04_1238 + 31997671-31998816                                        106   2e-23
03_02_0281 - 7069847-7069876,7070152-7070218,7071320-7071445,707...   106   2e-23
02_01_0464 - 3340642-3342015,3342403-3342405                          106   2e-23
01_06_0031 + 25760878-25761342                                        106   3e-23
09_04_0556 + 18500324-18500426,18501501-18501697,18501826-185018...   105   5e-23
08_01_0570 - 5073138-5073410,5075386-5075530,5075561-5075754          105   6e-23
10_08_0470 - 18151326-18151769                                        103   2e-22
05_05_0090 - 22310424-22310489,22310768-22310871,22312048-22312198    103   2e-22
03_02_0429 + 8378819-8378921,8379098-8379282,8380054-8380120,838...   102   3e-22
05_03_0115 - 8544590-8544958,8545408-8545503,8561954-8562505,857...   102   4e-22
01_06_0033 + 25765300-25765758                                         98   9e-21
06_03_0944 + 26202053-26202229,26203788-26204047,26204145-262042...    82   2e-18
08_01_0566 - 5028512-5029150                                           75   6e-14
10_08_0467 - 18143358-18143540,18144520-18144597,18144624-18145364     71   9e-13
07_03_0447 + 18301421-18301520,18301900-18302060                       71   2e-12
08_01_0571 - 5088060-5088314,5088826-5088868,5088911-5089137           66   3e-11
10_08_0796 + 20643667-20643912                                         51   1e-06
10_08_0361 + 17207657-17207701,17208850-17209773                       51   1e-06
10_02_0200 - 6672743-6673717,6676257-6676634,6677017-6677301,667...    48   1e-05
10_08_0468 - 18146369-18146701,18147267-18147467,18147525-181477...    46   4e-05
11_03_0129 - 10447736-10448356,10450418-10450504,10450632-104507...    43   4e-04
03_01_0224 - 1771582-1771727,1771855-1771980,1772489-1772517,177...    42   5e-04
12_01_1007 - 10208034-10208165,10208376-10208480,10208612-102086...    40   0.002
10_08_0799 - 20650799-20650947,20651022-20651114,20651906-206519...    40   0.002
08_02_0067 - 11863092-11863104,11863432-11863547,11863610-118639...    40   0.002
03_06_0392 - 33583375-33583554,33583646-33584126,33584211-33584452     40   0.002
02_02_0500 - 10993675-10994067,10994434-10995738                       40   0.003
02_01_0742 + 5524149-5524214,5524609-5524641,5524750-5524880,552...    39   0.005
06_02_0244 - 13445023-13445400,13445495-13446823                       36   0.043
12_01_1006 - 10206188-10206469                                         34   0.17 
06_03_0924 - 25976629-25976979,25977471-25978424,25978512-259785...    34   0.17 
06_01_0365 + 2606873-2607787                                           33   0.23 
09_04_0560 - 18519024-18519145,18519330-18519435,18519671-185199...    33   0.30 
02_02_0240 + 8196140-8198248,8198381-8198650                           33   0.40 
02_04_0476 + 23248222-23248495,23249558-23249790                       31   0.93 
01_06_1727 + 39477107-39477395,39477493-39477722                       31   1.6  
04_04_0281 + 24121267-24121537,24122567-24122799                       30   2.8  
04_04_0291 - 24177550-24177731,24179855-24179921                       29   3.8  
12_02_0908 - 24214221-24215933                                         29   5.0  
01_06_1230 + 35575840-35576020,35576122-35576170,35576365-355764...    28   8.7  

>01_03_0108 - 12628711-12629178
          Length = 155

 Score =  171 bits (417), Expect = 5e-43
 Identities = 87/135 (64%), Positives = 97/135 (71%), Gaps = 1/135 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV      
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDE-NGKIHRLRRECTGEQCGAGVFMAVM 535
                 K Y+ P          KLAVL+FYKVD+  GK+ RLR+EC   +CGAG FMA  
Sbjct: 77  AKKRKKKTYTKPKKQKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNAECGAGTFMANH 136

Query: 534 EDRHYCGKCHSTMVF 490
            DRHYCGKC  T V+
Sbjct: 137 FDRHYCGKCGLTYVY 151


>05_01_0438 + 3475017-3475484
          Length = 155

 Score =  171 bits (416), Expect = 6e-43
 Identities = 87/135 (64%), Positives = 96/135 (71%), Gaps = 1/135 (0%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVXXXXXX 712
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV      
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76

Query: 711 XXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDE-NGKIHRLRRECTGEQCGAGVFMAVM 535
                 K Y+ P          KLAVL+FYKVD+  GK+ RLR+EC    CGAG FMA  
Sbjct: 77  AKKRKKKTYTKPKKIKHKHKKVKLAVLQFYKVDDATGKVTRLRKECPNNDCGAGTFMANH 136

Query: 534 EDRHYCGKCHSTMVF 490
            DRHYCGKC  T V+
Sbjct: 137 FDRHYCGKCGLTYVY 151


>09_06_0335 +
           22391378-22391480,22391580-22391769,22392747-22392813,
           22393177-22393206
          Length = 129

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70


>09_04_0554 + 18495073-18495175,18495794-18496032
          Length = 113

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70


>09_04_0354 +
           16919133-16919235,16920145-16920355,16920478-16920544,
           16920767-16920808
          Length = 140

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70


>09_04_0148 + 15106392-15106484,15107517-15107776,15107920-15108028
          Length = 153

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score = 78.6 bits (185), Expect = 6e-15
 Identities = 33/54 (61%), Positives = 44/54 (81%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+DTI+ +K ++++KEGIPP QQRLI+AGKQL D +T  DYNI+  S LHLV
Sbjct: 93  IEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYNIEGGSVLHLV 146


>07_03_0427 - 18080959-18081079,18081203-18081410,18081608-18081710
          Length = 143

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70


>06_03_1149 + 28018932-28020529,28020989-28021067
          Length = 558

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 321 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 374



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 397 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 450



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 473 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 526


>06_03_1097 -
           27570037-27570262,27570575-27570730,27570763-27570881,
           27572154-27572236,27574991-27575041,27575218-27575674,
           27576139-27576228,27576672-27576701
          Length = 403

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 57  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 110



 Score =  101 bits (242), Expect = 8e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SD I+NVKAKIQDKEGIPP+QQRLIFA KQLEDGRTL+DYNIQKESTLHLV
Sbjct: 133 VESSDKIDNVKAKIQDKEGIPPDQQRLIFADKQLEDGRTLADYNIQKESTLHLV 186


>04_04_1238 + 31997671-31998816
          Length = 381

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 93  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 146



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 169 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 222



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 245 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 298



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 321 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 374



 Score =  105 bits (252), Expect = 5e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70


>03_02_0281 -
           7069847-7069876,7070152-7070218,7071320-7071445,
           7071727-7071916,7072008-7072110
          Length = 171

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70


>02_01_0464 - 3340642-3342015,3342403-3342405
          Length = 458

 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 18  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 71



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 94  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 147



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 170 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 223



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 246 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 299



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 322 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 375



 Score =  106 bits (255), Expect = 2e-23
 Identities = 50/54 (92%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 398 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 451


>01_06_0031 + 25760878-25761342
          Length = 154

 Score =  106 bits (254), Expect = 3e-23
 Identities = 49/54 (90%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAK+QDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIQNVKAKVQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score = 69.3 bits (162), Expect = 4e-12
 Identities = 28/54 (51%), Positives = 41/54 (75%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E +DT++ +K +++++EGIPP QQRLI+ GKQL D +T  DY I+  S LHLV
Sbjct: 93  IEMTDTVDRIKERVEEREGIPPVQQRLIYGGKQLADDKTAHDYKIEAGSVLHLV 146


>09_04_0556 +
           18500324-18500426,18501501-18501697,18501826-18501892,
           18502300-18502370
          Length = 145

 Score =  105 bits (252), Expect = 5e-23
 Identities = 49/54 (90%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQL+DGRTL+DYNIQKESTLHLV
Sbjct: 17  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLV 70


>08_01_0570 - 5073138-5073410,5075386-5075530,5075561-5075754
          Length = 203

 Score =  105 bits (251), Expect = 6e-23
 Identities = 49/54 (90%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLE+GRTL+DYNIQKESTLHLV
Sbjct: 130 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLV 183


>10_08_0470 - 18151326-18151769
          Length = 147

 Score =  103 bits (247), Expect = 2e-22
 Identities = 59/126 (46%), Positives = 74/126 (58%), Gaps = 5/126 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL---VXXX 721
           +EPSDT+E+VK K+ DKEG+PP+QQ LIF G QL+DG TL  Y IQ+ESTLHL   +   
Sbjct: 22  MEPSDTVESVKVKLVDKEGLPPDQQPLIFQGHQLDDGHTLIYYGIQEESTLHLLGRICGG 81

Query: 720 XXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDE-NGKIHRLRRECTGEQC-GAGVF 547
                    K Y+TP          +LAVLR Y+VD+  GK+ RLR  C   +C   G  
Sbjct: 82  GGGNKKRKKKAYATPKKGKHEHRKEELAVLRHYRVDDVMGKVERLRLMCPNPECKDVGAL 141

Query: 546 MAVMED 529
           MA   D
Sbjct: 142 MAKHHD 147


>05_05_0090 - 22310424-22310489,22310768-22310871,22312048-22312198
          Length = 106

 Score =  103 bits (247), Expect = 2e-22
 Identities = 49/54 (90%), Positives = 52/54 (96%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDG TL+DYNIQKESTLHLV
Sbjct: 33  VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKESTLHLV 86


>03_02_0429 +
           8378819-8378921,8379098-8379282,8380054-8380120,
           8380516-8380544,8380739-8380774
          Length = 139

 Score =  102 bits (245), Expect = 3e-22
 Identities = 48/54 (88%), Positives = 51/54 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VE SD + NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VENSDAVANVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70


>05_03_0115 -
           8544590-8544958,8545408-8545503,8561954-8562505,
           8576247-8576312,8576623-8576694,8576967-8577082,
           8577743-8577838,8578498-8578765
          Length = 544

 Score =  102 bits (244), Expect = 4e-22
 Identities = 48/53 (90%), Positives = 51/53 (96%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           VE SDTI+NVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTL+ YNIQKESTLHL
Sbjct: 484 VESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAGYNIQKESTLHL 536



 Score = 80.6 bits (190), Expect = 2e-15
 Identities = 36/40 (90%), Positives = 40/40 (100%)
 Frame = -2

Query: 849 QDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +DKEGIPP+QQRLIFAGKQL+DGRTL+DYNIQKESTLHLV
Sbjct: 422 RDKEGIPPDQQRLIFAGKQLKDGRTLADYNIQKESTLHLV 461


>01_06_0033 + 25765300-25765758
          Length = 152

 Score = 97.9 bits (233), Expect = 9e-21
 Identities = 43/54 (79%), Positives = 51/54 (94%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+  D++ENVKA+I D+EG+PP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 17  VDSCDSVENVKARIHDREGVPPHQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 70



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 20/51 (39%), Positives = 34/51 (66%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTL 739
           +EP+DT+  +K +I ++EG      RL++ GKQL D +T+ +Y+I+  S L
Sbjct: 94  IEPTDTMGRIKERIDEREG------RLVYGGKQLADDKTVHEYDIEAGSVL 138


>06_03_0944 +
           26202053-26202229,26203788-26204047,26204145-26204245,
           26204512-26204584,26205482-26205581
          Length = 236

 Score = 81.8 bits (193), Expect(2) = 2e-18
 Identities = 37/39 (94%), Positives = 39/39 (100%)
 Frame = -2

Query: 846 DKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           DKEGIPP+QQRLIFAGKQLEDGRTL+DYNIQKESTLHLV
Sbjct: 60  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV 98



 Score = 78.6 bits (185), Expect = 6e-15
 Identities = 33/54 (61%), Positives = 44/54 (81%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +EP+DTI+ +K ++++KEGIPP QQRLI+AGKQL D +T  DYNI+  S LHLV
Sbjct: 121 IEPTDTIDRIKERVEEKEGIPPVQQRLIYAGKQLADDKTAKDYNIEGGSVLHLV 174



 Score = 29.1 bits (62), Expect(2) = 2e-18
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQ 847
           VE SDTI+NVKAKIQ
Sbjct: 17  VESSDTIDNVKAKIQ 31


>08_01_0566 - 5028512-5029150
          Length = 212

 Score = 75.4 bits (177), Expect = 6e-14
 Identities = 35/53 (66%), Positives = 42/53 (79%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V P DT+  VKAKIQ K GIP  QQRL+FAG+ LEDGRTL++Y I+KE+ LHL
Sbjct: 17  VNPWDTVGKVKAKIQAKGGIPAAQQRLMFAGRHLEDGRTLAEYGIKKEANLHL 69


>10_08_0467 - 18143358-18143540,18144520-18144597,18144624-18145364
          Length = 333

 Score = 71.3 bits (167), Expect = 9e-13
 Identities = 31/53 (58%), Positives = 44/53 (83%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           VEPSDT+E+VK ++Q+K+G+PP QQRLIF G+QL+DG T++   I+K S L+L
Sbjct: 86  VEPSDTVESVKLQLQEKDGLPPCQQRLIFEGRQLDDGDTVASCGIRKHSYLNL 138



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 27/55 (49%), Positives = 41/55 (74%), Gaps = 2/55 (3%)
 Frame = -2

Query: 891 VEPSDTIENVKAKI--QDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V+PSDT+ +VK K+  + K+   P +QRL+F+G +L D RTL+ Y I++ESTL+L
Sbjct: 192 VQPSDTVGSVKVKLYYRKKKKTMPCKQRLVFSGMELADDRTLASYGIEEESTLYL 246



 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 27/53 (50%), Positives = 36/53 (67%), Gaps = 3/53 (5%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLE--DG-RTLSDYNIQKEST 742
           VEPSDT+E+VKAKI+   GI      L + GKQ++  DG RTL+DY I+  +T
Sbjct: 17  VEPSDTVESVKAKIKAMSGI-TEDFGLAYDGKQMDEADGHRTLADYGIRDPAT 68


>07_03_0447 + 18301421-18301520,18301900-18302060
          Length = 86

 Score = 70.5 bits (165), Expect = 2e-12
 Identities = 34/53 (64%), Positives = 40/53 (75%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           VE SDTI +VK KI DK GIP + QRL+ AG+QL+D RTL+DY IQ E TL L
Sbjct: 16  VEGSDTIGDVKVKIHDKNGIPADDQRLMHAGRQLDDRRTLADYGIQTEHTLRL 68


>08_01_0571 - 5088060-5088314,5088826-5088868,5088911-5089137
          Length = 174

 Score = 66.5 bits (155), Expect = 3e-11
 Identities = 38/58 (65%), Positives = 45/58 (77%), Gaps = 4/58 (6%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRL--IFAG-KQLED-GRTLSDYNIQKESTLHLV 730
           V PSDTI++VKAKIQDK GI  +QQ L  + AG KQL+D G TL+DY+I  ESTLHLV
Sbjct: 108 VRPSDTIDDVKAKIQDKVGIRSDQQHLVDVSAGSKQLDDGGSTLADYDIHDESTLHLV 165


>10_08_0796 + 20643667-20643912
          Length = 81

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 22/54 (40%), Positives = 35/54 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +E ++T+  +K +++  EGIPP QQ LI+ G+QL D  T    +++  S LHLV
Sbjct: 20  IEATETVARIKEQVEAAEGIPPPQQTLIYGGRQLADDMTAEMCDLRHGSELHLV 73


>10_08_0361 + 17207657-17207701,17208850-17209773
          Length = 322

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 21/51 (41%), Positives = 39/51 (76%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           S++I ++KA+I+ +EGI  N+Q L++AG+QLED + LS  +++ + T H++
Sbjct: 106 SNSIADIKAEIEQEEGILMNEQILMYAGQQLEDNQLLSQCDLRNDQTFHVL 156



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 20/53 (37%), Positives = 34/53 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           V  +DT++ +K+K+   EGI  ++Q + FAG  L++   L+DYNI   S++ L
Sbjct: 28  VNSTDTVDQIKSKLSAIEGIDKSKQEMFFAGMHLKNEDKLADYNIMTNSSVDL 80


>10_02_0200 -
           6672743-6673717,6676257-6676634,6677017-6677301,
           6677420-6677570,6677696-6677930,6678689-6678764
          Length = 699

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 20/54 (37%), Positives = 38/54 (70%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+ S+++ +VK +I+ KEGI  + Q L++AG+QL+D + LS + +  +  LH++
Sbjct: 444 VKNSNSVADVKVEIERKEGILQDNQMLMYAGRQLDDRQILSHFGLSDDQILHVL 497


>10_08_0468 -
           18146369-18146701,18147267-18147467,18147525-18147773,
           18148058-18148090
          Length = 271

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 25/51 (49%), Positives = 35/51 (68%), Gaps = 2/51 (3%)
 Frame = -2

Query: 888 EPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLED--GRTLSDYNIQKEST 742
           EPSDT+E+VKAKI+D  GI  +   L + GKQ+++   RTL+DY I   +T
Sbjct: 17  EPSDTVESVKAKIKDMSGITEDFW-LRYDGKQMDEVGSRTLADYGIHDPAT 66


>11_03_0129 -
           10447736-10448356,10450418-10450504,10450632-10450742,
           10453876-10453935,10454262-10454345,10455200-10455298
          Length = 353

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 20/54 (37%), Positives = 35/54 (64%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+ SD + +VK +I+ KEGI  + Q L++AG+ L D + LS+  +  +  LH++
Sbjct: 169 VKKSDIVADVKLQIELKEGIHLDNQILMYAGRHLGDSQILSECGLSDDHILHVL 222


>03_01_0224 -
           1771582-1771727,1771855-1771980,1772489-1772517,
           1772689-1772747,1772816-1772929,1773030-1773238,
           1773347-1774087,1775678-1776238,1776295-1776419,
           1778187-1778317,1779020-1779178,1779471-1779728,
           1780140-1780164,1780531-1780592,1780944-1781003,
           1781112-1781219,1781703-1781838,1781880-1781929,
           1782024-1782096,1782209-1782345,1782441-1782527,
           1782624-1782721,1783259-1783369,1783685-1783769,
           1783880-1783969
          Length = 1259

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 17/44 (38%), Positives = 30/44 (68%)
 Frame = -2

Query: 861 KAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           KA + +   +P  QQRLI+ G+ L+D +TL+ Y ++ + T+H+V
Sbjct: 753 KAIVAESCDVPAPQQRLIYKGRILKDEQTLASYGVETDHTIHMV 796


>12_01_1007 -
           10208034-10208165,10208376-10208480,10208612-10208673,
           10210820-10211456
          Length = 311

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 19/49 (38%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+  +K  +  +EGIP   QRL FAG +L+D      Y+I + ST+ L+
Sbjct: 22  TVRRIKEYVLRQEGIPVESQRLFFAGAELDDDGDTERYSILQGSTVLLL 70


>10_08_0799 -
           20650799-20650947,20651022-20651114,20651906-20651934,
           20652039-20652097,20652170-20652283,20652374-20652534,
           20652544-20652663,20652741-20653469,20654980-20655244
          Length = 572

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T+   K  +     +P  QQRLI+ G+ L+D +TL  Y ++ + T+H+V
Sbjct: 51  TVGAFKEVVAGSCDVPAAQQRLIYKGRILKDEQTLESYGVETDHTIHMV 99


>08_02_0067 -
           11863092-11863104,11863432-11863547,11863610-11863950,
           11864978-11865331,11866055-11866150,11866812-11866980,
           11867541-11867618,11867745-11867926,11868010-11868094,
           11868545-11868648,11869510-11869590,11870123-11870240,
           11871299-11871430,11871635-11871788,11871838-11871917
          Length = 700

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 21/45 (46%), Positives = 27/45 (60%)
 Frame = -2

Query: 864 VKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +K KI    GI   QQRLI  G+ L+D   LS Y+++   TLHLV
Sbjct: 128 LKEKIATVTGILSEQQRLICRGRVLKDDELLSAYHVEDGHTLHLV 172


>03_06_0392 - 33583375-33583554,33583646-33584126,33584211-33584452
          Length = 300

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDG-RTLSDYNIQKESTLHL 733
           T+  VK  +  +E I    QRL FAG+ L+D  RTL+DY ++ +S + L
Sbjct: 23  TVAQVKGMVMARERIAVAMQRLFFAGRCLDDDHRTLADYGVRHDSVVFL 71


>02_02_0500 - 10993675-10994067,10994434-10995738
          Length = 565

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLE-DGRTLSDYNIQKESTLHLV 730
           SD++ +VK +IQ  +G    +QRL+F+G +L  +   + DY +   + LHLV
Sbjct: 51  SDSVASVKLRIQQFKGFVTTKQRLVFSGHELSLNNSHVRDYGLTDGNVLHLV 102



 Score = 29.9 bits (64), Expect = 2.8
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = -2

Query: 819 QRLIFAGKQLEDGRTLSDYNIQKESTLHL 733
           QRL+F G++LED + ++D + +  + +HL
Sbjct: 152 QRLVFDGEELEDNQLIADISKKGAAVIHL 180


>02_01_0742 +
           5524149-5524214,5524609-5524641,5524750-5524880,
           5525174-5525282,5525406-5525522,5525896-5525961,
           5526314-5526376,5526459-5526503,5526690-5526751,
           5526974-5527067,5527375-5527467,5527561-5527630,
           5527816-5527892,5527976-5528033,5528135-5528166,
           5528245-5528376
          Length = 415

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 16/54 (29%), Positives = 34/54 (62%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V+P +++EN+KA ++ +  +P  QQ+L F G+++++   LS   +Q    + +V
Sbjct: 17  VDPDESVENLKALLEVETSVPLRQQQLHFNGREIQNTDKLSTVGVQDGDLVMMV 70


>06_02_0244 - 13445023-13445400,13445495-13446823
          Length = 568

 Score = 35.9 bits (79), Expect = 0.043
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQL-EDGRTLSDYNIQKESTLHLV 730
           S++I +VK +IQ  +G   N+QRL+  G +L  +   + DY +   + LHLV
Sbjct: 59  SESIASVKLRIQRFKGFVVNKQRLVLDGHELARNNCHVKDYGLADGNVLHLV 110


>12_01_1006 - 10206188-10206469
          Length = 93

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 15/53 (28%), Positives = 31/53 (58%), Gaps = 2/53 (3%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLED--GRTLSDYNIQKESTLHLV 730
           + +++ +K  + ++EG P   QR  F G ++++    T  +Y+I K ST+ L+
Sbjct: 29  TSSLQRMKTAVMNQEGFPVQHQRPFFGGVEMQEKGDDTTREYSIVKGSTIDLL 81


>06_03_0924 -
           25976629-25976979,25977471-25978424,25978512-25978565,
           25979135-25979254,25979357-25979532,25979624-25980107,
           25980541-25980744,25981671-25981877,25982179-25982271,
           25982433-25982621,25983364-25983423,25983591-25983927,
           25984195-25984432,25984614-25984816,25985549-25986554,
           25987125-25987290,25987715-25987824,25987944-25988195,
           25988360-25988402,25988488-25988550,25989512-25989624,
           25990787-25990838
          Length = 1824

 Score = 33.9 bits (74), Expect = 0.17
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQ-RLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           V   +T  +VK+K   K    P+++ +L  +GK+L+D  +L+  N++  S LH+V
Sbjct: 652 VNAEETPLSVKSKASKKLEFKPSEKIKLFCSGKELQDDISLAMQNVRPNSILHVV 706


>06_01_0365 + 2606873-2607787
          Length = 304

 Score = 33.5 bits (73), Expect = 0.23
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNI 757
           VEP D +  +K K++   GIP   Q L++  ++L D   +  Y I
Sbjct: 22  VEPFDKVVEIKQKVESCYGIPVTAQCLLYWNRELADDHDIEYYPI 66


>09_04_0560 -
           18519024-18519145,18519330-18519435,18519671-18519907,
           18521371-18521810,18523215-18525012
          Length = 900

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = -2

Query: 879 DTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           DT+  V A + D+ G      RL++AG+QL     L+D  +  +STLHL+
Sbjct: 100 DTVGAVLAHLADR-GYG-RDLRLVYAGRQLAPETALADLRLPPDSTLHLL 147


>02_02_0240 + 8196140-8198248,8198381-8198650
          Length = 792

 Score = 32.7 bits (71), Expect = 0.40
 Identities = 16/42 (38%), Positives = 26/42 (61%)
 Frame = -2

Query: 882 SDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNI 757
           SDT+ ++K +I  +  +P N+Q+L      L+D  TL+ YNI
Sbjct: 733 SDTVGSLKEQIAGELQLPANKQKLSVRTSFLKDNLTLAYYNI 774


>02_04_0476 + 23248222-23248495,23249558-23249790
          Length = 168

 Score = 31.5 bits (68), Expect = 0.93
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLED 784
           +  + T   +K ++    G+ P +QRL+F GK+ ED
Sbjct: 85  IAATSTFGELKVRLSMVTGLEPREQRLLFRGKERED 120


>01_06_1727 + 39477107-39477395,39477493-39477722
          Length = 172

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 14/54 (25%), Positives = 29/54 (53%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           ++ + T  ++K  +    G+ P  QRL++ GK+ +DG  L    +Q +  + L+
Sbjct: 90  IDSTATFGDLKVMLSLVTGLWPRDQRLLYKGKERDDGDHLHMVGVQDKDKVLLL 143


>04_04_0281 + 24121267-24121537,24122567-24122799
          Length = 167

 Score = 29.9 bits (64), Expect = 2.8
 Identities = 14/49 (28%), Positives = 25/49 (51%)
 Frame = -2

Query: 876 TIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           T   +K  +    G+ P +QRL+F GK+ ED   L    ++ +  + L+
Sbjct: 89  TFGELKTVVSIVTGLEPREQRLLFRGKEREDSDHLHMVGVRDKDKVLLL 137


>04_04_0291 - 24177550-24177731,24179855-24179921
          Length = 82

 Score = 29.5 bits (63), Expect = 3.8
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = -2

Query: 864 VKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSD 766
           +KA +    G+ P +QR +F GK+ ED   L D
Sbjct: 25  LKAVVSMVTGLEPREQRPLFRGKEREDSDHLKD 57


>12_02_0908 - 24214221-24215933
          Length = 570

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 16/48 (33%), Positives = 27/48 (56%)
 Frame = +3

Query: 189 VNLISK*IHKNLKSCESRVGARDRIETSLTVGRPISIFIRTEAAQVRC 332
           ++LI K +H++L    +RVGA   +  SL +G   ++ + T AA   C
Sbjct: 98  LHLIKKPLHRSLAEVAARVGAAPVV--SLRLGARRALLVSTHAAAEEC 143


>01_06_1230 +
           35575840-35576020,35576122-35576170,35576365-35576441,
           35576883-35577145,35577241-35577387,35578569-35578766
          Length = 304

 Score = 28.3 bits (60), Expect = 8.7
 Identities = 13/45 (28%), Positives = 22/45 (48%)
 Frame = -2

Query: 864 VKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           +K  +    G+ P +QRL F GK+  D   L    ++  + L L+
Sbjct: 105 LKGVLTQATGVEPERQRLFFRGKEKSDNEFLHTAGVKDGAKLLLL 149


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,061,308
Number of Sequences: 37544
Number of extensions: 444641
Number of successful extensions: 1329
Number of sequences better than 10.0: 49
Number of HSP's better than 10.0 without gapping: 1251
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1320
length of database: 14,793,348
effective HSP length: 82
effective length of database: 11,714,740
effective search space used: 2506954360
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).